Gene Gene information from NCBI Gene database.
Entrez ID 1960
Gene name Early growth response 3
Gene symbol EGR3
Synonyms (NCBI Gene)
EGR-3PILOT
Chromosome 8
Chromosome location 8p21.3
Summary This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the t
miRNA miRNA information provided by mirtarbase database.
657
miRTarBase ID miRNA Experiments Reference
MIRT004963 hsa-let-7a-5p qRT-PCR 17942906
MIRT018262 hsa-miR-335-5p Microarray 18185580
MIRT029689 hsa-miR-26b-5p Microarray 19088304
MIRT542153 hsa-miR-8485 HITS-CLIP 21572407
MIRT542152 hsa-miR-603 HITS-CLIP 21572407
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
NFATC1 Unknown 9819402
NFATC2 Unknown 9819402
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602419 3240 ENSG00000179388
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q06889
Protein name Early growth response protein 3 (EGR-3) (Zinc finger protein pilot)
Protein function Probable transcription factor involved in muscle spindle development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11928 DUF3446 87 156 Early growth response N-terminal domain Domain
PF00096 zf-C2H2 275 299 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 305 327 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 333 355 Zinc finger, C2H2 type Domain
Sequence
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSE
PVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
Sequence length 387
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  C-type lectin receptor signaling pathway
Hepatitis B
Viral carcinogenesis
  NGF-stimulated transcription
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EGR3-related disorder Uncertain significance rs1403960253, rs867051535 RCV003397771
RCV003897272
Neurodevelopmental delay Uncertain significance rs1803935143 RCV001253432
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 31340147
Anencephaly Associate 24634123
Arthritis Juvenile Associate 39699225
Asthma Associate 37102654
Bipolar Disorder Associate 19839995, 20633309, 22370066
Bipolar Disorder Inhibit 27163206
Breast Neoplasms Associate 37999751
Carcinoma Hepatocellular Associate 28070994, 32138690
Carcinoma Hepatocellular Inhibit 36046377
Carcinoma Pancreatic Ductal Associate 40410886