Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1960
Gene name Gene Name - the full gene name approved by the HGNC.
Early growth response 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EGR3
Synonyms (NCBI Gene) Gene synonyms aliases
EGR-3, PILOT
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004963 hsa-let-7a-5p qRT-PCR 17942906
MIRT018262 hsa-miR-335-5p Microarray 18185580
MIRT029689 hsa-miR-26b-5p Microarray 19088304
MIRT542153 hsa-miR-8485 HITS-CLIP 21572407
MIRT542152 hsa-miR-603 HITS-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
NFATC1 Unknown 9819402
NFATC2 Unknown 9819402
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602419 3240 ENSG00000179388
Protein
UniProt ID Q06889
Protein name Early growth response protein 3 (EGR-3) (Zinc finger protein pilot)
Protein function Probable transcription factor involved in muscle spindle development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11928 DUF3446 87 156 Early growth response N-terminal domain Domain
PF00096 zf-C2H2 275 299 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 305 327 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 333 355 Zinc finger, C2H2 type Domain
Sequence
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSE
PVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
Sequence length 387
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  C-type lectin receptor signaling pathway
Hepatitis B
Viral carcinogenesis
  NGF-stimulated transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Otosclerosis Otosclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 31340147
Anencephaly Associate 24634123
Arthritis Juvenile Associate 39699225
Asthma Associate 37102654
Bipolar Disorder Associate 19839995, 20633309, 22370066
Bipolar Disorder Inhibit 27163206
Breast Neoplasms Associate 37999751
Carcinoma Hepatocellular Associate 28070994, 32138690
Carcinoma Hepatocellular Inhibit 36046377
Carcinoma Pancreatic Ductal Associate 40410886