Gene Gene information from NCBI Gene database.
Entrez ID 1944
Gene name Ephrin A3
Gene symbol EFNA3
Synonyms (NCBI Gene)
EFL2EPLG3Ehk1-LLERK3
Chromosome 1
Chromosome location 1q21.3
Summary This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a
miRNA miRNA information provided by mirtarbase database.
416
miRTarBase ID miRNA Experiments Reference
MIRT002024 hsa-miR-210-3p Luciferase reporter assayWestern blot 18417479
MIRT002024 hsa-miR-210-3p Luciferase reporter assay 18539147
MIRT002024 hsa-miR-210-3p Luciferase reporter assay 18417479
MIRT002024 hsa-miR-210-3p immunoprecipitaionqRT-PCR 19826008
MIRT002024 hsa-miR-210-3p Luciferase reporter assayWestern blot 19551852
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005005 Function Transmembrane-ephrin receptor activity TAS 8660976
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 24217950
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601381 3223 ENSG00000143590
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P52797
Protein name Ephrin-A3 (EFL-2) (EHK1 ligand) (EHK1-L) (EPH-related receptor tyrosine kinase ligand 3) (LERK-3)
Protein function Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 30 166 Ephrin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVC
CASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
MicroRNAs in cancer
  EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BELL'S PALSY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CATARACT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 35770949
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Associate 33862227
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 22866899
★☆☆☆☆
Found in Text Mining only
Brain Diseases Associate 36672180
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 23981902, 32005108, 33977106
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Inhibit 35770949
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 35227773, 39223584
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Associate 16965393
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 39233640
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Associate 32322884
★☆☆☆☆
Found in Text Mining only