Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1936
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation elongation factor 1 delta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EEF1D
Synonyms (NCBI Gene) Gene synonyms aliases	EF-1D, EF1D, FP1047, NEDTCHAL
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 i

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1563978827	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045464	hsa-miR-149-5p	CLASH	23622248
MIRT045464	hsa-miR-149-5p	CLASH	23622248
MIRT044945	hsa-miR-186-5p	CLASH	23622248
MIRT038906	hsa-miR-93-3p	CLASH	23622248
MIRT038906	hsa-miR-93-3p	CLASH	23622248
MIRT440749	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440749	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1982199	hsa-miR-1204	CLIP-seq
MIRT1982200	hsa-miR-1207-5p	CLIP-seq
MIRT1982201	hsa-miR-3155	CLIP-seq
MIRT1982202	hsa-miR-3155b	CLIP-seq
MIRT1982203	hsa-miR-329	CLIP-seq
MIRT1982204	hsa-miR-362-3p	CLIP-seq
MIRT1982205	hsa-miR-3918	CLIP-seq
MIRT1982206	hsa-miR-3941	CLIP-seq
MIRT1982207	hsa-miR-4264	CLIP-seq
MIRT1982208	hsa-miR-4512	CLIP-seq
MIRT1982209	hsa-miR-4736	CLIP-seq
MIRT1982210	hsa-miR-4763-3p	CLIP-seq
MIRT1982211	hsa-miR-4797-3p	CLIP-seq
MIRT1982212	hsa-miR-484	CLIP-seq
MIRT1982213	hsa-miR-510	CLIP-seq
MIRT1982214	hsa-miR-603	CLIP-seq
MIRT1982215	hsa-miR-622	CLIP-seq
MIRT1982199	hsa-miR-1204	CLIP-seq
MIRT1982200	hsa-miR-1207-5p	CLIP-seq
MIRT1982203	hsa-miR-329	CLIP-seq
MIRT1982204	hsa-miR-362-3p	CLIP-seq
MIRT1982205	hsa-miR-3918	CLIP-seq
MIRT1982206	hsa-miR-3941	CLIP-seq
MIRT1982207	hsa-miR-4264	CLIP-seq
MIRT1982208	hsa-miR-4512	CLIP-seq
MIRT1982209	hsa-miR-4736	CLIP-seq
MIRT1982210	hsa-miR-4763-3p	CLIP-seq
MIRT1982211	hsa-miR-4797-3p	CLIP-seq
MIRT1982214	hsa-miR-603	CLIP-seq
MIRT1982215	hsa-miR-622	CLIP-seq
MIRT1982199	hsa-miR-1204	CLIP-seq
MIRT1982200	hsa-miR-1207-5p	CLIP-seq
MIRT1982203	hsa-miR-329	CLIP-seq
MIRT1982204	hsa-miR-362-3p	CLIP-seq
MIRT1982205	hsa-miR-3918	CLIP-seq
MIRT1982206	hsa-miR-3941	CLIP-seq
MIRT1982208	hsa-miR-4512	CLIP-seq
MIRT1982209	hsa-miR-4736	CLIP-seq
MIRT1982210	hsa-miR-4763-3p	CLIP-seq
MIRT1982214	hsa-miR-603	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003746	Function	Translation elongation factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16169070, 16189514, 17500595, 20195357, 21988832, 21994455, 25416956, 25609649, 25959826, 29128334, 30021884, 31515488, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	8743958
GO:0005783	Component	Endoplasmic reticulum	IDA	8743958
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005853	Component	Eukaryotic translation elongation factor 1 complex	IEA
GO:0006414	Process	Translational elongation	IBA	21873635
GO:0006414	Process	Translational elongation	TAS
GO:0008135	Function	Translation factor activity, RNA binding	TAS	8334168
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	12761501
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	8168075

MIM	HGNC	e!Ensembl
130592	3211	ENSG00000104529

Protein

UniProt ID

P29692

Protein name

Elongation factor 1-delta (EF-1-delta) (Antigen NY-CO-4)

Protein function

[Isoform 1]: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP, regenerating EF-1-alpha for another round of transfer of aminoacyl-tRNAs to the ribosome.; [Isoform 2]: Regulates induction of heat-shock-r

PDB

2MVM , 2MVN , 2N51 , 5JPO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10587	EF-1_beta_acid	159 → 186	Eukaryotic elongation factor 1 beta central acidic region	Domain
PF00736	EF1_GNE	197 → 281	EF-1 guanine nucleotide exchange domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is specifically expressed in brain, cerebellum and testis.

Sequence

MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKS
LAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSP
GHRATAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLR
QYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGI
RKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI

Sequence length

281

Interactions

View interactions

	Reactome
			Eukaryotic Translation Elongation

EEF1D (eukaryotic translation elongation factor 1 delta)