Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1933
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation elongation factor 1 beta 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EEF1B2
Synonyms (NCBI Gene) Gene synonyms aliases
EEF1B, EEF1B1, EF1B
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5` U
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050124 hsa-miR-26a-5p CLASH 23622248
MIRT045403 hsa-miR-149-5p CLASH 23622248
MIRT043864 hsa-miR-378a-3p CLASH 23622248
MIRT650600 hsa-miR-548m HITS-CLIP 23824327
MIRT650599 hsa-miR-548ag HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003746 Function Translation elongation factor activity IEA
GO:0003746 Function Translation elongation factor activity NAS 1886777
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005515 Function Protein binding IPI 16169070, 16189514, 25416956, 25959826, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IDA 12426392
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600655 3208 ENSG00000114942
Protein
UniProt ID P24534
Protein name Elongation factor 1-beta (EF-1-beta) (eEF-1B alpha)
Protein function Catalytic subunit of the guanine nucleotide exchange factor (GEF) (eEF1B subcomplex) of the eukaryotic elongation factor 1 complex (eEF1) (By similarity). Stimulates the exchange of GDP for GTP on elongation factor 1A (eEF1A), probably by displa
PDB 1B64 , 5DQS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10587 EF-1_beta_acid 103 130 Eukaryotic elongation factor 1 beta central acidic region Domain
PF00736 EF1_GNE 141 225 EF-1 guanine nucleotide exchange domain Domain
Sequence
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKK
AKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Eukaryotic Translation Elongation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neurodevelopmental Disorders neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34225819
Breast Neoplasms Associate 17127214, 20005186
Lung Neoplasms Associate 29342219
Myocardial Infarction Associate 35864510
Neoplasms Associate 27225414
Neoplasms Stimulate 29342219
Sarcoma Kaposi Associate 40016701