Gene Gene information from NCBI Gene database.
Entrez ID 1933
Gene name Eukaryotic translation elongation factor 1 beta 2
Gene symbol EEF1B2
Synonyms (NCBI Gene)
EEF1BEEF1B1EF1B
Chromosome 2
Chromosome location 2q33.3
Summary This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5` U
miRNA miRNA information provided by mirtarbase database.
34
miRTarBase ID miRNA Experiments Reference
MIRT050124 hsa-miR-26a-5p CLASH 23622248
MIRT045403 hsa-miR-149-5p CLASH 23622248
MIRT043864 hsa-miR-378a-3p CLASH 23622248
MIRT650600 hsa-miR-548m HITS-CLIP 23824327
MIRT650599 hsa-miR-548ag HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0003746 Function Translation elongation factor activity IEA
GO:0003746 Function Translation elongation factor activity NAS 1886777
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005515 Function Protein binding IPI 16169070, 16189514, 25416956, 25959826, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IDA 12426392
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600655 3208 ENSG00000114942
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P24534
Protein name Elongation factor 1-beta (EF-1-beta) (eEF-1B alpha)
Protein function Catalytic subunit of the guanine nucleotide exchange factor (GEF) (eEF1B subcomplex) of the eukaryotic elongation factor 1 complex (eEF1) (By similarity). Stimulates the exchange of GDP for GTP on elongation factor 1A (eEF1A), probably by displa
PDB 1B64 , 5DQS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10587 EF-1_beta_acid 103 130 Eukaryotic elongation factor 1 beta central acidic region Domain
PF00736 EF1_GNE 141 225 EF-1 guanine nucleotide exchange domain Domain
Sequence
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKK
AKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Eukaryotic Translation Elongation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Global developmental delay Pathogenic rs765917912, rs2105784954 RCV001806458
RCV001806459
Intellectual disability Pathogenic rs1576016842 RCV000850165
Moderate global developmental delay Pathogenic rs1576016842 RCV000850165
Seizure Pathogenic rs1576016842 RCV000850165
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34225819
Breast Neoplasms Associate 17127214, 20005186
Lung Neoplasms Associate 29342219
Myocardial Infarction Associate 35864510
Neoplasms Associate 27225414
Neoplasms Stimulate 29342219
Sarcoma Kaposi Associate 40016701