Gene Gene information from NCBI Gene database.
Entrez ID 192286
Gene name HIG1 hypoxia inducible domain family member 2A
Gene symbol HIGD2A
Synonyms (NCBI Gene)
HIG2ARCF1b
Chromosome 5
Chromosome location 5q35.2
Summary The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholo
miRNA miRNA information provided by mirtarbase database.
160
miRTarBase ID miRNA Experiments Reference
MIRT256742 hsa-miR-181a-5p HITS-CLIP 22473208
MIRT256743 hsa-miR-181b-5p HITS-CLIP 22473208
MIRT256744 hsa-miR-181c-5p HITS-CLIP 22473208
MIRT256746 hsa-miR-181d-5p HITS-CLIP 22473208
MIRT1046028 hsa-miR-1273g CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620788 28311 ENSG00000146066
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BW72
Protein name HIG1 domain family member 2A, mitochondrial (RCF1 homolog B) (RCF1b)
Protein function Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04588 HIG_1_N 45 96 Hypoxia induced protein conserved region Family
Sequence
MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAAL
TYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLG
LAVTAMKSRP
Sequence length 106
Interactions View interactions