Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
192286
Gene name Gene Name - the full gene name approved by the HGNC.
HIG1 hypoxia inducible domain family member 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HIGD2A
Synonyms (NCBI Gene) Gene synonyms aliases
HIG2A, RCF1b
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT256742 hsa-miR-181a-5p HITS-CLIP 22473208
MIRT256743 hsa-miR-181b-5p HITS-CLIP 22473208
MIRT256744 hsa-miR-181c-5p HITS-CLIP 22473208
MIRT256746 hsa-miR-181d-5p HITS-CLIP 22473208
MIRT1046028 hsa-miR-1273g CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620788 28311 ENSG00000146066
Protein
UniProt ID Q9BW72
Protein name HIG1 domain family member 2A, mitochondrial (RCF1 homolog B) (RCF1b)
Protein function Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04588 HIG_1_N 45 96 Hypoxia induced protein conserved region Family
Sequence
MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAAL
TYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLG
LAVTAMKSRP
Sequence length 106
Interactions View interactions
<