Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1906
Gene name	Endothelin 1
Gene symbol	EDN1
Synonyms (NCBI Gene)	ARCND3ET1HDLCQ7PPET1QME
Chromosome	6
Chromosome location	6p24.1
Summary	This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatme

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777231	A>G	Pathogenic	Missense variant, coding sequence variant
rs587777232	C>A	Pathogenic	Missense variant, coding sequence variant
rs587777233	T>A	Pathogenic	Missense variant, coding sequence variant
rs587777234	T>G	Pathogenic	Stop gained, coding sequence variant

387

Show/Hide all (387)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004455	hsa-miR-155-5p	Luciferase reporter assay	19783678
MIRT005432	hsa-miR-199a-5p	Luciferase reporter assay	19783678
MIRT006855	hsa-miR-1-3p	Luciferase reporter assay	22963810
MIRT006855	hsa-miR-1-3p	Luciferase reporter assay	22963810
MIRT022267	hsa-miR-124-3p	Microarray	18668037
MIRT006855	hsa-miR-1-3p	Microarray	18668037
MIRT006855	hsa-miR-1-3p	Luciferase reporter assayqRT-PCR	25394359
MIRT006855	hsa-miR-1-3p	MicroarrayELISAqRT-PCR	24394957
MIRT006855	hsa-miR-1-3p	MicroarrayELISAqRT-PCR	24394957
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT477747	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT477746	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT244069	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT244068	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT244067	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT244066	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT244065	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT244070	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT244074	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT244073	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT244075	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT244087	hsa-miR-4458	PAR-CLIP	23592263
MIRT244088	hsa-miR-4500	PAR-CLIP	23592263
MIRT244083	hsa-miR-4295	PAR-CLIP	23592263
MIRT244079	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT244085	hsa-miR-3666	PAR-CLIP	23592263
MIRT244081	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT244078	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT244076	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT244077	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT244086	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT244091	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT477745	hsa-miR-6074	PAR-CLIP	23592263
MIRT477744	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT244080	hsa-miR-759	PAR-CLIP	23592263
MIRT477743	hsa-miR-1279	PAR-CLIP	23592263
MIRT477742	hsa-miR-8060	PAR-CLIP	23592263
MIRT477741	hsa-miR-4769-3p	PAR-CLIP	23592263
MIRT477740	hsa-miR-6817-5p	PAR-CLIP	23592263
MIRT477739	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT244089	hsa-miR-4710	PAR-CLIP	23592263
MIRT244082	hsa-miR-1294	PAR-CLIP	23592263
MIRT244090	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT477738	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT477737	hsa-miR-433-3p	PAR-CLIP	23592263
MIRT378367	hsa-miR-4727-5p	PAR-CLIP	23592263
MIRT477736	hsa-miR-5001-3p	PAR-CLIP	23592263
MIRT378368	hsa-miR-6738-3p	PAR-CLIP	23592263
MIRT477735	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT006855	hsa-miR-1-3p	Luciferase reporter assayqRT-PCR	28042875
MIRT244073	hsa-miR-98-5p	Luciferase reporter assay	26098770
MIRT732169	hsa-miR-125a-5p	Luciferase reporter assay	27106952
MIRT732169	hsa-miR-125a-5p	Luciferase reporter assay	27106952
MIRT006855	hsa-miR-1-3p	ELISALuciferase reporter assayqRT-PCRWestern blot	28493075
MIRT006855	hsa-miR-1-3p	ELISALuciferase reporter assayqRT-PCRWestern blot	28493075
MIRT244076	hsa-miR-130a-3p	Luciferase reporter assayqRT-PCR	33314303
MIRT244078	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCR	33314303
MIRT244065	hsa-let-7a-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT244066	hsa-let-7b-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT244070	hsa-let-7f-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT477747	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT477746	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT244069	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT244068	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT244067	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT244066	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT244065	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT244070	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT244074	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT244073	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT244075	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT244087	hsa-miR-4458	PAR-CLIP	23592263
MIRT244088	hsa-miR-4500	PAR-CLIP	23592263
MIRT244083	hsa-miR-4295	PAR-CLIP	23592263
MIRT244079	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT244085	hsa-miR-3666	PAR-CLIP	23592263
MIRT244081	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT244078	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT244076	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT244077	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT244086	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT244091	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT477745	hsa-miR-6074	PAR-CLIP	23592263
MIRT477744	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT244080	hsa-miR-759	PAR-CLIP	23592263
MIRT477743	hsa-miR-1279	PAR-CLIP	23592263
MIRT477742	hsa-miR-8060	PAR-CLIP	23592263
MIRT477741	hsa-miR-4769-3p	PAR-CLIP	23592263
MIRT477740	hsa-miR-6817-5p	PAR-CLIP	23592263
MIRT477739	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT244089	hsa-miR-4710	PAR-CLIP	23592263
MIRT244082	hsa-miR-1294	PAR-CLIP	23592263
MIRT244090	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT477738	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT477737	hsa-miR-433-3p	PAR-CLIP	23592263
MIRT378367	hsa-miR-4727-5p	PAR-CLIP	23592263
MIRT477736	hsa-miR-5001-3p	PAR-CLIP	23592263
MIRT378368	hsa-miR-6738-3p	PAR-CLIP	23592263
MIRT477735	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT006855	hsa-miR-1-3p	MicroarrayqRT-PCR	35899934
MIRT756052	hsa-miR-575	MicroarrayqRT-PCR	35899934
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952661	hsa-miR-1275	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952665	hsa-miR-132	CLIP-seq
MIRT952666	hsa-miR-1909	CLIP-seq
MIRT952667	hsa-miR-194	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952669	hsa-miR-212	CLIP-seq
MIRT952670	hsa-miR-214	CLIP-seq
MIRT952671	hsa-miR-299-3p	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952674	hsa-miR-3134	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952680	hsa-miR-3619-5p	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT952685	hsa-miR-410	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952687	hsa-miR-4426	CLIP-seq
MIRT952688	hsa-miR-4476	CLIP-seq
MIRT952689	hsa-miR-4525	CLIP-seq
MIRT952690	hsa-miR-4534	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952692	hsa-miR-4647	CLIP-seq
MIRT952693	hsa-miR-4648	CLIP-seq
MIRT952694	hsa-miR-4651	CLIP-seq
MIRT952695	hsa-miR-4654	CLIP-seq
MIRT952696	hsa-miR-4662b	CLIP-seq
MIRT952697	hsa-miR-4665-5p	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952699	hsa-miR-4676-5p	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952701	hsa-miR-4699-5p	CLIP-seq
MIRT952702	hsa-miR-4723-5p	CLIP-seq
MIRT952703	hsa-miR-4747-5p	CLIP-seq
MIRT952704	hsa-miR-4769-5p	CLIP-seq
MIRT952705	hsa-miR-4786-3p	CLIP-seq
MIRT952706	hsa-miR-4802-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT756052	hsa-miR-575	CLIP-seq
MIRT952709	hsa-miR-584	CLIP-seq
MIRT952710	hsa-miR-608	CLIP-seq
MIRT952711	hsa-miR-625	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952713	hsa-miR-671-5p	CLIP-seq
MIRT952714	hsa-miR-761	CLIP-seq
MIRT952715	hsa-miR-765	CLIP-seq
MIRT952716	hsa-miR-802	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952661	hsa-miR-1275	CLIP-seq
MIRT952718	hsa-miR-1305	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952719	hsa-miR-185	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952720	hsa-miR-2113	CLIP-seq
MIRT952671	hsa-miR-299-3p	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952721	hsa-miR-3659	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT952722	hsa-miR-4306	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952688	hsa-miR-4476	CLIP-seq
MIRT952689	hsa-miR-4525	CLIP-seq
MIRT952690	hsa-miR-4534	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952723	hsa-miR-4644	CLIP-seq
MIRT952693	hsa-miR-4648	CLIP-seq
MIRT952695	hsa-miR-4654	CLIP-seq
MIRT952724	hsa-miR-4658	CLIP-seq
MIRT952725	hsa-miR-4663	CLIP-seq
MIRT952697	hsa-miR-4665-5p	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952726	hsa-miR-4693-3p	CLIP-seq
MIRT952702	hsa-miR-4723-5p	CLIP-seq
MIRT952727	hsa-miR-4758-5p	CLIP-seq
MIRT952704	hsa-miR-4769-5p	CLIP-seq
MIRT952728	hsa-miR-4775	CLIP-seq
MIRT952706	hsa-miR-4802-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT952729	hsa-miR-511	CLIP-seq
MIRT952730	hsa-miR-544	CLIP-seq
MIRT952731	hsa-miR-574-5p	CLIP-seq
MIRT952732	hsa-miR-590-3p	CLIP-seq
MIRT952711	hsa-miR-625	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952715	hsa-miR-765	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952666	hsa-miR-1909	CLIP-seq
MIRT952670	hsa-miR-214	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT1982109	hsa-miR-33a	CLIP-seq
MIRT1982110	hsa-miR-33b	CLIP-seq
MIRT952680	hsa-miR-3619-5p	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952694	hsa-miR-4651	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952703	hsa-miR-4747-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT952710	hsa-miR-608	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952714	hsa-miR-761	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT1982109	hsa-miR-33a	CLIP-seq
MIRT1982110	hsa-miR-33b	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT952709	hsa-miR-584	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT2679769	hsa-miR-4729	CLIP-seq
MIRT2679770	hsa-miR-513c	CLIP-seq
MIRT2679771	hsa-miR-514b-5p	CLIP-seq
MIRT2679772	hsa-miR-579	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
FOXO1	Unknown	19887561
HIF1A	Activation	19783678
JUN	Unknown	12208352
NFKB1	Unknown	21334436
NR1H4	Repression	16357303
RELA	Unknown	21334436
STAT1	Activation	20217138

183

Show/Hide all (183)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19767294
GO:0000165	Process	MAPK cascade	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001821	Process	Histamine secretion	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0003015	Process	Heart process	IEA
GO:0003094	Process	Glomerular filtration	IEA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IBA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IDA	2649896
GO:0003253	Process	Cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA
GO:0003357	Process	Noradrenergic neuron differentiation	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IDA	19767294
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	2649896, 10770212
GO:0005515	Function	Protein binding	IPI	17446437, 23597562
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10770212, 15691296, 16820593
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	12379507
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	30990108
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006885	Process	Regulation of pH	IEA
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	1713452
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17078114
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007267	Process	Cell-cell signaling	IDA	12379507
GO:0007411	Process	Axon guidance	IEA
GO:0007507	Process	Heart development	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0007589	Process	Body fluid secretion	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	1917960, 17078114
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0010193	Process	Response to ozone	IEA
GO:0010460	Process	Positive regulation of heart rate	IDA	2649896
GO:0010467	Process	Gene expression	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	TAS	8999856
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IDA	12847114
GO:0010629	Process	Negative regulation of gene expression	IDA	16820593
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010827	Process	Regulation of D-glucose transmembrane transport	IEA
GO:0014032	Process	Neural crest cell development	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0014034	Process	Neural crest cell fate commitment	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014824	Process	Artery smooth muscle contraction	IDA	8982507
GO:0014824	Process	Artery smooth muscle contraction	IEA
GO:0014824	Process	Artery smooth muscle contraction	TAS	1725334
GO:0014826	Process	Vein smooth muscle contraction	IBA
GO:0014826	Process	Vein smooth muscle contraction	IDA	9422810
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	10770212
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	16820593
GO:0030072	Process	Peptide hormone secretion	IDA	10770212
GO:0030133	Component	Transport vesicle	TAS
GO:0030185	Process	Nitric oxide transport	IDA	16820593
GO:0030195	Process	Negative regulation of blood coagulation	TAS	16820593
GO:0030335	Process	Positive regulation of cell migration	IDA	9696419
GO:0030593	Process	Neutrophil chemotaxis	IDA	9696419
GO:0030878	Process	Thyroid gland development	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IDA	9492062
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IEA
GO:0031707	Function	Endothelin A receptor binding	IBA
GO:0031707	Function	Endothelin A receptor binding	IDA	10770212
GO:0031707	Function	Endothelin A receptor binding	IEA
GO:0031708	Function	Endothelin B receptor binding	IBA
GO:0031708	Function	Endothelin B receptor binding	IDA	10770212
GO:0031708	Function	Endothelin B receptor binding	IEA
GO:0031708	Function	Endothelin B receptor binding	IPI	1713452
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033093	Component	Weibel-Palade body	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0034696	Process	Response to prostaglandin F	IEA
GO:0035050	Process	Embryonic heart tube development	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042045	Process	Epithelial fluid transport	IEA
GO:0042310	Process	Vasoconstriction	IDA	2649896, 11410113
GO:0042310	Process	Vasoconstriction	IEA
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0042482	Process	Positive regulation of odontogenesis	IEA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043179	Process	Rhythmic excitation	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10770212, 12847114
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17078114
GO:0044321	Process	Response to leptin	IEA
GO:0044751	Process	Cellular response to human chorionic gonadotropin stimulus	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0045321	Process	Leukocyte activation	TAS	16820593
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	TAS	8999856
GO:0045793	Process	Positive regulation of cell size	IDA	12847114
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	10770212
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24117217
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IBA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12847114
GO:0046887	Process	Positive regulation of hormone secretion	IDA	10770212
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048237	Component	Rough endoplasmic reticulum lumen	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10393673
GO:0048675	Process	Axon extension	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	1917960
GO:0051216	Process	Cartilage development	IEA
GO:0051248	Process	Negative regulation of protein metabolic process	IDA	19767294
GO:0051899	Process	Membrane depolarization	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060137	Process	Maternal process involved in parturition	IEA
GO:0060298	Process	Positive regulation of sarcomere organization	IMP	12847114
GO:0060385	Process	Axonogenesis involved in innervation	IEA
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IDA	24117217
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IGI	24117217
GO:0061626	Process	Pharyngeal arch artery morphogenesis	IEA
GO:0070101	Process	Positive regulation of chemokine-mediated signaling pathway	IDA	17178876
GO:0070294	Process	Renal sodium ion absorption	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	30990108
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0071373	Process	Cellular response to luteinizing hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071389	Process	Cellular response to mineralocorticoid stimulus	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072011	Process	Glomerular endothelium development	IEA
GO:0072112	Process	Podocyte differentiation	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IDA	9492062, 16820593
GO:0086100	Process	Endothelin receptor signaling pathway	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0086101	Process	Endothelin receptor signaling pathway involved in heart process	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097237	Process	Cellular response to toxic substance	IDA	30990108
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097492	Process	Sympathetic neuron axon guidance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0141156	Process	CAMP/PKA signal transduction	IDA	30990108
GO:0160195	Process	Negative regulation of phospholipase C/protein kinase C signal transduction	IDA	16820593
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1902074	Process	Response to salt	IEA
GO:1902287	Process	Semaphorin-plexin signaling pathway involved in axon guidance	IEA
GO:1903537	Process	Meiotic cell cycle process involved in oocyte maturation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1905653	Process	Positive regulation of artery morphogenesis	IEA
GO:2001259	Process	Positive regulation of cation channel activity	IDA	30990108

MIM	HGNC	e!Ensembl
131240	3176	ENSG00000078401

P05305

Protein name

Endothelin-1 (Preproendothelin-1) (PPET1) [Cleaved into: Endothelin-1 (ET-1); Big endothelin-1]

Protein function

Endothelins are endothelium-derived vasoconstrictor peptides (By similarity). Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells (P

PDB

1EDN , 1EDP , 1T7H , 1V6R , 5GLH , 6DK5 , 8HCQ , 8HCX , 8IY5 , 8IY6 , 8XGR , 8XVE , 8XVH , 8XVI , 8XWP , 8XWQ , 8ZRT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00322	Endothelin	49 → 77	Endothelin family	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung, placental stem villi vessels and in cultured placental vascular smooth muscle cells. {ECO:0000269|PubMed:9284755}.

Sequence

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Sequence length

212

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway HIF-1 signaling pathway Neuroactive ligand-receptor interaction Vascular smooth muscle contraction TNF signaling pathway Melanogenesis Renin secretion Relaxin signaling pathway AGE-RAGE signaling pathway in diabetic complications Pathways in cancer Hypertrophic cardiomyopathy Fluid shear stress and atherosclerosis		Peptide ligand-binding receptors G alpha (q) signalling events

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Auriculocondylar syndrome 3	Pathogenic	rs587777231, rs587777232	RCV000106312 RCV000106313
Question mark ears, isolated	Pathogenic	rs587777233, rs587777234	RCV000106314 RCV000106315

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EDN1-related disorder	Likely benign; Benign	rs755064642, rs150035515, rs148565651	RCV003967272 RCV003914312 RCV003930623
High density lipoprotein cholesterol level quantitative trait locus 7	Benign	rs5370	RCV000018132

Show/Hide Text Mining Associations (333)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Ablepharon macrostomia syndrome	Associate	35468098
Acute Chest Syndrome	Associate	28548215
Acute Coronary Syndrome	Associate	26573609
Acute Lung Injury	Stimulate	26071554
Adenocarcinoma of Lung	Associate	31698633
Adenoma	Associate	26313302
AIDS Dementia Complex	Associate	17197385
Airway Obstruction	Associate	17470272
Alopecia	Associate	37749230
Altitude Sickness	Associate	21217075, 32214168
Alzheimer Disease	Associate	19541930
Amyotrophic Lateral Sclerosis	Associate	27814735, 30150298
Anemia Sickle Cell	Associate	25403488, 28548215, 34956203
Anemia Sickle Cell	Stimulate	7635951
Aneurysm	Associate	8301307
Angina Pectoris Variant	Associate	10462023
Aortic Valve Stenosis	Associate	10400911, 35181609
Appendicitis	Associate	12529269
Arterial Occlusive Diseases	Associate	22633685, 25486928
Arteriosclerosis	Associate	9734624
Asthma	Associate	16920889, 17470272, 19247692, 19371341, 21103062, 9701415
Asthma	Stimulate	26071554
Astrocytoma	Associate	16007684, 8664342
Atherosclerosis	Associate	15863881, 19672034, 22321643, 24607773, 29654172, 35527471, 40076930, 9786493
Atrial Fibrillation	Stimulate	20495015
Atrial Fibrillation	Associate	28701603, 29940585, 30513109, 34332113
Atrial Standstill	Associate	20495015
Auriculo condylar syndrome	Associate	24268655, 25026904
Blast Injuries	Associate	21765001
Bone Diseases	Associate	10917552
Bone Marrow Diseases	Associate	32383346
Bone Resorption	Inhibit	10917552
Brain Diseases	Associate	9453574
Brain Injuries	Associate	22633685, 36007264
Brain Injuries Traumatic	Associate	31553988
Brain Ischemia	Associate	10700441, 22997346
Breast Neoplasms	Associate	15226779, 16984733, 22006997, 24373848
Bronchiectasis	Associate	10933101
Bronchiolitis Obliterans	Associate	21078427
Bronchiolitis Obliterans Syndrome	Associate	21078427
Bronchitis Chronic	Associate	21932697
Calcinosis Cutis	Associate	24069190
Capillary Leak Syndrome	Associate	26176954
Carcinogenesis	Associate	36475746, 7560095
Carcinoma Basal Cell	Stimulate	17241596
Carcinoma Ductal Breast	Stimulate	17158636
Carcinoma Hepatocellular	Associate	26420968, 35896520
Carcinoma in Situ	Associate	24373848
Carcinoma Non Small Cell Lung	Associate	15646831, 28153500
Carcinoma Ovarian Epithelial	Associate	24530737
Carcinoma Renal Cell	Associate	15139053, 24136229
Carcinoma Squamous Cell	Associate	29630085
Cardiomegaly	Associate	10400911, 32878883
Cardiomegaly	Stimulate	36544188
Cardiomyopathies	Stimulate	16584112
Cardiomyopathy Dilated	Associate	16095497, 20495015
Cardiomyopathy Hypertrophic	Stimulate	16920889, 32878883, 33582159
Cardiovascular Abnormalities	Associate	35205232
Cardiovascular Diseases	Associate	10077237, 21777246, 23315480, 26573599, 30753341
Cardiovascular Diseases	Inhibit	21057729
Cardiovascular Diseases	Stimulate	22971991
Cartilage Diseases	Associate	14558091, 15743480, 23565184
Central Nervous System Diseases	Associate	18379872
Cerebral Hemorrhage	Associate	32168316
Cerebral Infarction	Associate	27106952
Cerebral Palsy	Associate	36384316
Cerebrovascular Disorders	Associate	19460784, 22527129, 28692114
Cerebrovascular Disorders	Stimulate	21677282
Chondrosarcoma	Associate	27602960
Chorioamnionitis	Associate	2005113
Choriocarcinoma	Associate	18362896
Cleft Lip	Associate	34032749
Cognition Disorders	Associate	36384316
Colorectal Neoplasms	Associate	11034585, 12521131, 28249901, 28708138, 30444664, 36453252
Complex Regional Pain Syndromes	Stimulate	17137491
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	23884103
Corneal Injuries	Associate	32016117
Coronary Aneurysm	Associate	26573609
Coronary Artery Disease	Stimulate	11087242
Coronary Artery Disease	Associate	19672034, 29654172, 30621952, 30994493, 31972008, 32499477, 35801781, 9786493
Coronary Artery Dissection Spontaneous	Associate	30621952, 31707208, 33866193
Coronary Disease	Associate	26573599, 31972008
COVID 19	Associate	34789851
Cushing Syndrome	Stimulate	31909455
Cystic Fibrosis	Associate	19460784, 39543807
Death	Associate	18953265, 22527129, 22971991
Dementia	Associate	27106952
Diabetes Mellitus	Associate	15863881, 18806884, 19421330, 20664700, 21169360
Diabetes Mellitus	Stimulate	22326504, 22972845, 25104521, 35468098
Diabetes Mellitus Type 2	Associate	18806884, 20664700, 24607773, 26190179, 27789766, 39217825
Diabetes Mellitus Type 2	Stimulate	19581418
Diabetic Nephropathies	Associate	19415232
Diabetic Nephropathies	Stimulate	22250646
Diabetic Retinopathy	Associate	18806884, 20664700
Diastrophic dysplasia	Stimulate	12628714
Down Syndrome	Associate	25222269
Dysplastic Nevus Syndrome	Associate	26703564
Edema	Associate	20055806
Emphysema	Associate	21932697
Emphysematous Cholecystitis	Associate	21932697
Encephalitis	Associate	12807444
Endometrial Neoplasms	Associate	36542159, 7819049
Endplate Acetylcholinesterase Deficiency	Associate	23565184
Epiretinal Membrane	Associate	16030497
Epstein Barr Virus Infections	Associate	36373306
Epstein Barr Virus Infections	Inhibit	36475746
Esophageal Neoplasms	Associate	17663518
Esophageal Squamous Cell Carcinoma	Associate	17663518
Esophagitis	Stimulate	32947843
Essential Hypertension	Associate	28692114, 35645613
Eye Diseases	Associate	15988412
Facial Pain	Associate	7750653
Failed Back Surgery Syndrome	Associate	15821752
Fetal Growth Retardation	Associate	22580289
Fever	Associate	37749230
Fibromuscular Dysplasia	Associate	30621952
Fibrosis	Associate	16095497, 16185925, 20495015, 21169360, 22527129, 24507687, 32317146, 32947843, 35468098
Fuchs' Endothelial Dystrophy	Associate	21757643
Gastritis Atrophic	Inhibit	32947843
Gaucher like disease	Associate	37005330
Giant Cell Arteritis	Stimulate	28606962
Glaucoma	Associate	12692512, 15988412, 18420197
Glioblastoma	Associate	11092528, 16007684, 36766848
Glioma	Associate	31734650, 34020533, 36796652
Glomerulonephritis	Associate	16928614
Glomerulonephritis IGA	Associate	17328840, 22250646
Glomerulonephritis IGA	Stimulate	29137483
Glucose Intolerance	Associate	33967958
Glycosuria Renal	Stimulate	31777301
Granulomatous Disease Chronic	Inhibit	32251485
Hand Arm Vibration Syndrome	Associate	9457906
Heart Arrest	Associate	36141455
Heart Defects Congenital	Associate	18603063, 21498912, 26617785, 27450023
Heart Diseases	Associate	10700441, 20335527, 26260101
Heart Diseases	Stimulate	31199841
Heart Failure	Associate	10816056, 11278891, 18953265, 9588211
Heart Failure	Stimulate	20495015, 22615818
Heart Valve Diseases	Associate	24896159
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26543229
HIV Infections	Associate	17197385
Hydronephrosis	Associate	29028084
Hyperaldosteronism	Associate	8083364
Hyperglycemia	Stimulate	33147748
Hyperglycemia	Associate	33967958
Hyperinsulinism	Stimulate	27796268
Hyperinsulinism	Associate	33967958
Hyperkeratosis lenticularis perstans	Stimulate	27787379
Hyperpigmentation	Associate	15140230, 21557930
Hyperpigmentation	Stimulate	23884103
Hyperplasia	Associate	28606962
Hypertension	Associate	10438717, 15188945, 15369130, 18603063, 18806884, 19421330, 19672034, 20495015, 21757643, 28692114, 30753341, 34895646, 35205232, 35645613, 35981003, 9734624, 9787140 View all (2 more)
Hypertension	Stimulate	19653178, 26206738
Hypertension Portal	Associate	24507687
Hypertension Pregnancy Induced	Stimulate	39503530
Hypertension Pulmonary	Associate	18822124, 20335527, 25403488, 27425626, 28514291, 34011397, 35186226, 36179900, 8497283
Hyperthyroidism	Stimulate	30513109
Hypertrophy	Stimulate	16920889, 35017014, 36977605
Hypertrophy	Associate	20495015
Hypertrophy Left Ventricular	Associate	15188945
Hypoplastic Left Heart Syndrome	Associate	18603063
Hypotension	Associate	15188945
Hypoxia	Stimulate	11278891, 12963716, 24933425, 25138825, 30237409, 30301761, 31116583, 34942165, 8901607, 9588211
Hypoxia	Associate	15646831, 22552325, 24373848, 31734650, 36141455
Hypoxia Brain	Stimulate	22552325
Hypoxia Brain	Associate	31734650
Idiopathic Pulmonary Fibrosis	Associate	22527129, 32899090, 7615852
Infarction Anterior Cerebral Artery	Associate	29849817
Infections	Associate	10933101
Inflammation	Associate	12529269, 17470272, 18457675, 19371341, 19640695, 21637825, 24486907, 25222269, 26071554, 26107453, 29654172, 30513109, 30753341, 30809683, 31230554, 33183050, 34789851, 36007264, 9004253 View all (4 more)
Inflammation	Inhibit	17467420
Inflammation	Stimulate	21496413, 21777246, 35468098, 8901607
Inflammatory Bowel Diseases	Associate	21637825
Insulin Resistance	Associate	30237409
Intracranial Aneurysm	Stimulate	39215680
Intracranial Hemorrhage Hypertensive	Associate	33275248
Ischemia	Associate	11278891, 12529269
Kaposiform Hemangioendothelioma	Associate	37978357
Keloid	Associate	35047146
Keratosis Seborrheic	Stimulate	17241596
Kidney Diseases	Associate	17328840, 17706018, 22250646, 28060893, 9734624
Kidney Failure Chronic	Associate	16526315, 28882114
Kidney Failure Chronic	Stimulate	31777301
Kidney Neoplasms	Stimulate	30116406
Leiomyoma	Associate	17716379, 25138825, 34942165
Lentigo	Associate	15140230, 17241596
Lentigo	Stimulate	25917897
Leukemia	Associate	24901342
Leukemia Lymphocytic Chronic B Cell	Associate	24901342
Livedoid Vasculopathy	Associate	26874031
Liver Diseases	Stimulate	28606962
Liver Failure	Inhibit	7615814
Low Tension Glaucoma	Associate	15988412, 16971893, 27777505
Lung Diseases	Associate	23056449, 9284832
Lung Neoplasms	Associate	28153500
Lupus Erythematosus Systemic	Associate	37749230
Lymphangioleiomyomatosis	Associate	30279475
Lymphatic Metastasis	Stimulate	29630085
Lymphatic Metastasis	Associate	36475746
Mandibular Diseases	Associate	7750653
Mandibulofacial Dysostosis	Associate	7750653
Melanoma	Associate	12189238, 12230494, 15610525, 16098041, 30614626, 8645250
Melanoma Cutaneous Malignant	Associate	8645250
Melanosis	Associate	21557930
Melanosis	Stimulate	32121626
Meningioma	Associate	16007684, 7560095, 7842471
Mental Disorders	Associate	23436272
Mesenteric Ischemia	Stimulate	25623906
Mesenteric Vascular Occlusion	Associate	28606962
Metabolic Diseases	Associate	7822272
Microphthalmos	Associate	26308584
Mitral Valve Insufficiency	Associate	20495015, 20563522, 31356682
Mitral Valve Stenosis	Associate	26107453, 36179900
Mucus Inspissation of Respiratory Tract	Associate	30072506
Multiple Myeloma	Stimulate	28597546
Muscular Diseases	Associate	35468098
Myocardial Infarction	Stimulate	35742539
Myocardial Infarction	Associate	35886020
Myocardial Ischemia	Stimulate	11278891, 19706169, 9588211
Myocardial Ischemia	Associate	26190179
Myocardial Reperfusion Injury	Associate	10438717, 8897762, 9787140
Nasopharyngeal Carcinoma	Associate	23987636
Neoplasm Metastasis	Stimulate	12521131, 27602960
Neoplasm Metastasis	Associate	15610525, 16098041, 19202075, 21656314, 24069190, 24373848, 24530737, 25556429, 26703564, 28153500
Neoplasms	Stimulate	11034585, 15139053, 17663518, 19527488, 22971991, 28597546, 29630085, 32235007
Neoplasms	Associate	11073829, 11092528, 12618891, 15083188, 15226779, 15646831, 16007684, 18457675, 18781169, 19202075, 2022753, 21656314, 22232246, 24530737, 25194819 View all (12 more)
Neoplasms Basal Cell	Associate	30382525
Neoplasms Glandular and Epithelial	Associate	2022753
Neoplasms Squamous Cell	Associate	17663518
Nephrotic Syndrome	Associate	24747133, 31981468, 34895646
Nerve Degeneration	Associate	21504125, 9787140
Neuraminidase deficiency with beta galactosidase deficiency	Associate	7822272
Neuroblastoma	Associate	16007684
Neuroinflammatory Diseases	Associate	18379872
Neurologic Manifestations	Associate	33275248, 9457906
Neutrophil Immunodeficiency Syndrome	Associate	9787140
No Reflow Phenomenon	Associate	29512098
No Reflow Phenomenon	Stimulate	35228564
Non alcoholic Fatty Liver Disease	Stimulate	34828420
Non Muscle Invasive Bladder Neoplasms	Associate	25627007
Obesity	Associate	24063765
Optic Nerve Diseases	Associate	18420197, 27777505
Optic Neuropathy Ischemic	Associate	23401650
Osteoarthritis	Associate	14558091, 15743480
Osteolysis	Associate	24373848
Osteosarcoma	Associate	21656314, 24069190, 24727660
Ovarian Diseases	Associate	19202075
Ovarian Neoplasms	Associate	11073813, 12023962, 15347673, 22232246, 24530737, 25194819, 29482638, 31865146
Overweight	Associate	15188945
Pain	Associate	17010672, 25486928
Pallor	Stimulate	9457906
Pancreatic Neoplasms	Associate	8198971
Pathological Conditions Anatomical	Associate	9284832
Pericarditis	Associate	37749230
Periodic fever familial autosomal dominant	Associate	30563869
Persistent Fetal Circulation Syndrome	Associate	27425626
Phyllodes Tumor	Associate	17158636
Pigmentary Disorder Reticulate with Systemic Manifestations	Stimulate	25159325
Pigmentation Disorders	Associate	15579452, 21557930, 23884103, 25268585
Polycystic Kidney Autosomal Dominant	Associate	16526315
Polycystic Ovary Syndrome	Stimulate	22727793
Polycystic Ovary Syndrome	Associate	31064393
Pre Eclampsia	Stimulate	22580289, 27864359
Pre Eclampsia	Associate	24933425
Preeclamptic toxemia	Stimulate	40187599
Preterm Premature Rupture of the Membranes	Associate	20673868
Primary Graft Dysfunction	Stimulate	20055806
Prostatic Neoplasms	Associate	10917552, 16026642, 18623111, 20725143, 25556429, 38087324
Prostatic Neoplasms	Stimulate	18781169, 34165174
Prostatic Neoplasms Castration Resistant	Stimulate	34165174
Proteinuria	Associate	16928614, 22250646, 40428357
Pruritus	Associate	30809683
Pulmonary Arterial Hypertension	Associate	16813666, 18822124, 19592490, 20190034, 22688668, 26252367, 28548215, 28608969, 29444773, 33611340, 37017914
Pulmonary Arterial Hypertension	Stimulate	21498912, 22299030, 26617785
Pulmonary Disease Chronic Obstructive	Associate	18822124, 19640695, 21932697, 29444773, 30072506, 35186226
Pulmonary edema of mountaineers	Associate	22984459, 36141455
Pulmonary edema of mountaineers	Stimulate	36141455
Pulmonary Embolism	Stimulate	26874031
Pulmonary Heart Disease	Associate	28548215
Pyuria	Associate	37749230
Radiculopathy	Associate	35002538
Raynaud Disease	Stimulate	37978357
Reflex Sympathetic Dystrophy	Associate	17137491
Reinfection	Associate	35136075
Renal Insufficiency Chronic	Associate	25801761, 33139635
Respiratory Distress Syndrome	Stimulate	26071554
Respiratory Distress Syndrome	Associate	27425626
Respiratory Hypersensitivity	Stimulate	21057729
Retinal Detachment	Stimulate	16030497
Rheumatic Diseases	Associate	20563522, 24896159
Rheumatic Fever	Associate	24896159
Rheumatic Heart Disease	Associate	36179900
Sarcoma Kaposi	Associate	23818101
Scleroderma Localized	Associate	38324287
Scleroderma Systemic	Associate	14632763, 16813666, 26357964, 9284832
Scleroderma Systemic	Stimulate	17907149, 21496413, 26584613, 30157947, 31667578
Scleroderma Systemic	Inhibit	32947843
Sepsis	Associate	26071554
Skin Diseases	Associate	32517074
Skin Neoplasms	Associate	17241596
Sleep Apnea Obstructive	Associate	28514291, 31116583
Spinal Cord Injuries	Stimulate	24968203
Spinocerebellar Ataxias	Associate	7473647
Squamous Cell Carcinoma of Head and Neck	Associate	30382525
ST Elevation Myocardial Infarction	Associate	35228564
Status Asthmaticus	Associate	11298190, 28548215
Status Asthmaticus	Stimulate	16920889
Stiff Skin Syndrome	Associate	26206738
Stomach Neoplasms	Associate	28493075, 36475746
Stomach Neoplasms	Inhibit	36373306
Stroke	Associate	10438717, 19661472
Stroke	Stimulate	19661472
Subarachnoid Hemorrhage	Associate	22997346, 35136075, 8301307
Sudden Infant Death	Associate	33559002
Symptom Flare Up	Stimulate	9457906
Syncope	Associate	35043642
Syncope Vasovagal	Associate	35043642
Thrombosis	Associate	28548215
Triple Negative Breast Neoplasms	Associate	22006997, 34326372
Univentricular Heart	Associate	18603063
Urinary Bladder Neoplasms	Associate	34286545
Varicocele	Associate	21601190
Varicose Ulcer	Stimulate	27994710
Varicose Veins	Associate	21601190
Vascular Diseases	Associate	24063765, 24376792, 24607773, 26308584, 27884380, 28753427, 29654172, 30621952, 30871567, 31230554, 31667578, 31909455, 31972008, 33967958, 40187599, 8497283 View all (1 more)
Vascular Diseases	Stimulate	24486907
Vascular Remodeling	Associate	19592490, 28606962
Vascular System Injuries	Associate	21496413, 37749230
Vasospasm Intracranial	Associate	22997346, 31595394, 36350075
Venous Thromboembolism	Associate	27481876
Vitamin D Deficiency	Associate	29216383
Vitreoretinopathy Proliferative	Stimulate	16030497
Williams Syndrome	Inhibit	23283491
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	31116583

EDN1 (endothelin 1)