Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1901
Gene name	Sphingosine-1-phosphate receptor 1
Gene symbol	S1PR1
Synonyms (NCBI Gene)	CD363CHEDG1D1S3362ECGF1EDG-1EDG1S1P1
Chromosome	1
Chromosome location	1p21.2
Summary	The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the

251

Show/Hide all (251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438751	hsa-miR-148a-3p	Hep3B	24798342
MIRT396670	hsa-miR-363-3p	Luciferase reporter assayqRT-PCRWestern blot	24631531
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assayWestern blotqRT-PCR	25251470
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assayWestern blotqRT-PCR	25251470
MIRT438751	hsa-miR-148a-3p	Hep3B	24798342
MIRT396670	hsa-miR-363-3p	Luciferase reporter assayqRT-PCRWestern blot	24631531
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assayWestern blotqRT-PCR	25251470
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assayWestern blotqRT-PCR	25251470
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT654062	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT654061	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT654060	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT654059	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT654058	hsa-miR-5193	HITS-CLIP	23824327
MIRT654057	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT654056	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT654055	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654054	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT654053	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT654052	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT654051	hsa-miR-7977	HITS-CLIP	23824327
MIRT654050	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT654049	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT654047	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654048	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT128036	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT128036	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT438751	hsa-miR-148a-3p	qRT-PCRLuciferase reporter assayWestern blot	25574238
MIRT438751	hsa-miR-148a-3p	qRT-PCRLuciferase reporter assayWestern blot	25574238
MIRT438751	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	26004261
MIRT438751	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	26004261
MIRT734561	hsa-miR-223-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	33574820
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT654062	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT654061	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT654060	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT654059	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT654058	hsa-miR-5193	HITS-CLIP	23824327
MIRT654057	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT654056	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT654055	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654054	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT654053	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT654052	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT654051	hsa-miR-7977	HITS-CLIP	23824327
MIRT654050	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT654049	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT654047	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654048	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT756272	hsa-miR-130a-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)ImmunofluorescenceFlow cytometryELISARNA pull down assay	36582210
MIRT1324329	hsa-miR-4307	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2393999	hsa-miR-186	CLIP-seq
MIRT2394000	hsa-miR-3133	CLIP-seq
MIRT2616415	hsa-miR-106a	CLIP-seq
MIRT2616416	hsa-miR-106b	CLIP-seq
MIRT2616417	hsa-miR-1231	CLIP-seq
MIRT2616418	hsa-miR-1260	CLIP-seq
MIRT2616419	hsa-miR-1260b	CLIP-seq
MIRT2616420	hsa-miR-1273e	CLIP-seq
MIRT2616421	hsa-miR-127-3p	CLIP-seq
MIRT2616422	hsa-miR-1279	CLIP-seq
MIRT2616423	hsa-miR-1293	CLIP-seq
MIRT2616424	hsa-miR-130a	CLIP-seq
MIRT2616425	hsa-miR-130b	CLIP-seq
MIRT2616426	hsa-miR-148a	CLIP-seq
MIRT2616427	hsa-miR-148b	CLIP-seq
MIRT2616428	hsa-miR-151-3p	CLIP-seq
MIRT2616429	hsa-miR-152	CLIP-seq
MIRT2616430	hsa-miR-155	CLIP-seq
MIRT2616431	hsa-miR-17	CLIP-seq
MIRT2616432	hsa-miR-181a	CLIP-seq
MIRT2616433	hsa-miR-181b	CLIP-seq
MIRT2616434	hsa-miR-181c	CLIP-seq
MIRT2616435	hsa-miR-181d	CLIP-seq
MIRT2616436	hsa-miR-188-3p	CLIP-seq
MIRT2616437	hsa-miR-19a	CLIP-seq
MIRT2616438	hsa-miR-19b	CLIP-seq
MIRT2616439	hsa-miR-2052	CLIP-seq
MIRT2616440	hsa-miR-20a	CLIP-seq
MIRT2616441	hsa-miR-20b	CLIP-seq
MIRT2616442	hsa-miR-24	CLIP-seq
MIRT2616443	hsa-miR-301a	CLIP-seq
MIRT2616444	hsa-miR-301b	CLIP-seq
MIRT2616445	hsa-miR-3065-5p	CLIP-seq
MIRT2616446	hsa-miR-3132	CLIP-seq
MIRT2616447	hsa-miR-3140-3p	CLIP-seq
MIRT2616448	hsa-miR-3146	CLIP-seq
MIRT2616449	hsa-miR-3156-3p	CLIP-seq
MIRT2616450	hsa-miR-3162-3p	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2616451	hsa-miR-3613-3p	CLIP-seq
MIRT2616452	hsa-miR-3653	CLIP-seq
MIRT2616453	hsa-miR-3658	CLIP-seq
MIRT2616454	hsa-miR-3666	CLIP-seq
MIRT2616455	hsa-miR-3684	CLIP-seq
MIRT2616456	hsa-miR-3688-3p	CLIP-seq
MIRT2616457	hsa-miR-377	CLIP-seq
MIRT2616458	hsa-miR-4261	CLIP-seq
MIRT2616459	hsa-miR-4262	CLIP-seq
MIRT2616460	hsa-miR-4279	CLIP-seq
MIRT2616461	hsa-miR-4284	CLIP-seq
MIRT2616462	hsa-miR-4287	CLIP-seq
MIRT2616463	hsa-miR-4288	CLIP-seq
MIRT2616464	hsa-miR-4295	CLIP-seq
MIRT2616465	hsa-miR-4469	CLIP-seq
MIRT2616466	hsa-miR-4477b	CLIP-seq
MIRT2616467	hsa-miR-4483	CLIP-seq
MIRT2616468	hsa-miR-450b-5p	CLIP-seq
MIRT2616469	hsa-miR-454	CLIP-seq
MIRT2616470	hsa-miR-4639-5p	CLIP-seq
MIRT2616471	hsa-miR-4643	CLIP-seq
MIRT2616472	hsa-miR-4645-5p	CLIP-seq
MIRT2616473	hsa-miR-4650-3p	CLIP-seq
MIRT2616474	hsa-miR-466	CLIP-seq
MIRT2616475	hsa-miR-4666-5p	CLIP-seq
MIRT2616476	hsa-miR-4673	CLIP-seq
MIRT2616477	hsa-miR-4685-3p	CLIP-seq
MIRT2616478	hsa-miR-4685-5p	CLIP-seq
MIRT2616479	hsa-miR-4694-5p	CLIP-seq
MIRT2616480	hsa-miR-4757-5p	CLIP-seq
MIRT2616481	hsa-miR-4766-5p	CLIP-seq
MIRT2616482	hsa-miR-4780	CLIP-seq
MIRT2616483	hsa-miR-4789-3p	CLIP-seq
MIRT2616484	hsa-miR-4802-3p	CLIP-seq
MIRT2616485	hsa-miR-518a-5p	CLIP-seq
MIRT2616486	hsa-miR-519d	CLIP-seq
MIRT2616487	hsa-miR-527	CLIP-seq
MIRT2616488	hsa-miR-543	CLIP-seq
MIRT2616489	hsa-miR-548a-5p	CLIP-seq
MIRT2616490	hsa-miR-548ab	CLIP-seq
MIRT2616491	hsa-miR-548ak	CLIP-seq
MIRT2616492	hsa-miR-548b-5p	CLIP-seq
MIRT2616493	hsa-miR-548c-5p	CLIP-seq
MIRT2616494	hsa-miR-548d-5p	CLIP-seq
MIRT2616495	hsa-miR-548h	CLIP-seq
MIRT2616496	hsa-miR-548i	CLIP-seq
MIRT2616497	hsa-miR-548j	CLIP-seq
MIRT2616498	hsa-miR-548k	CLIP-seq
MIRT2616499	hsa-miR-548l	CLIP-seq
MIRT2616500	hsa-miR-548n	CLIP-seq
MIRT2616501	hsa-miR-548t	CLIP-seq
MIRT2616502	hsa-miR-548w	CLIP-seq
MIRT2616503	hsa-miR-548y	CLIP-seq
MIRT2616504	hsa-miR-559	CLIP-seq
MIRT2616505	hsa-miR-561	CLIP-seq
MIRT2616506	hsa-miR-579	CLIP-seq
MIRT2616507	hsa-miR-602	CLIP-seq
MIRT2616508	hsa-miR-623	CLIP-seq
MIRT2616509	hsa-miR-632	CLIP-seq
MIRT2616510	hsa-miR-93	CLIP-seq
MIRT2616415	hsa-miR-106a	CLIP-seq
MIRT2616416	hsa-miR-106b	CLIP-seq
MIRT2616418	hsa-miR-1260	CLIP-seq
MIRT2616419	hsa-miR-1260b	CLIP-seq
MIRT2616421	hsa-miR-127-3p	CLIP-seq
MIRT2616422	hsa-miR-1279	CLIP-seq
MIRT2616423	hsa-miR-1293	CLIP-seq
MIRT2616424	hsa-miR-130a	CLIP-seq
MIRT2616425	hsa-miR-130b	CLIP-seq
MIRT2616426	hsa-miR-148a	CLIP-seq
MIRT2616427	hsa-miR-148b	CLIP-seq
MIRT2616428	hsa-miR-151-3p	CLIP-seq
MIRT2616429	hsa-miR-152	CLIP-seq
MIRT2616430	hsa-miR-155	CLIP-seq
MIRT2616431	hsa-miR-17	CLIP-seq
MIRT2616432	hsa-miR-181a	CLIP-seq
MIRT2616433	hsa-miR-181b	CLIP-seq
MIRT2616434	hsa-miR-181c	CLIP-seq
MIRT2616435	hsa-miR-181d	CLIP-seq
MIRT2616436	hsa-miR-188-3p	CLIP-seq
MIRT2616437	hsa-miR-19a	CLIP-seq
MIRT2616438	hsa-miR-19b	CLIP-seq
MIRT2616440	hsa-miR-20a	CLIP-seq
MIRT2616441	hsa-miR-20b	CLIP-seq
MIRT2616442	hsa-miR-24	CLIP-seq
MIRT2616443	hsa-miR-301a	CLIP-seq
MIRT2616444	hsa-miR-301b	CLIP-seq
MIRT2616445	hsa-miR-3065-5p	CLIP-seq
MIRT2616447	hsa-miR-3140-3p	CLIP-seq
MIRT2616448	hsa-miR-3146	CLIP-seq
MIRT2616449	hsa-miR-3156-3p	CLIP-seq
MIRT2616450	hsa-miR-3162-3p	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2616451	hsa-miR-3613-3p	CLIP-seq
MIRT2616452	hsa-miR-3653	CLIP-seq
MIRT2616453	hsa-miR-3658	CLIP-seq
MIRT2616454	hsa-miR-3666	CLIP-seq
MIRT2616455	hsa-miR-3684	CLIP-seq
MIRT2616456	hsa-miR-3688-3p	CLIP-seq
MIRT2616457	hsa-miR-377	CLIP-seq
MIRT2616458	hsa-miR-4261	CLIP-seq
MIRT2616459	hsa-miR-4262	CLIP-seq
MIRT2616461	hsa-miR-4284	CLIP-seq
MIRT2616462	hsa-miR-4287	CLIP-seq
MIRT2616464	hsa-miR-4295	CLIP-seq
MIRT2616465	hsa-miR-4469	CLIP-seq
MIRT2616466	hsa-miR-4477b	CLIP-seq
MIRT2616467	hsa-miR-4483	CLIP-seq
MIRT2616469	hsa-miR-454	CLIP-seq
MIRT2616470	hsa-miR-4639-5p	CLIP-seq
MIRT2616471	hsa-miR-4643	CLIP-seq
MIRT2616474	hsa-miR-466	CLIP-seq
MIRT2616475	hsa-miR-4666-5p	CLIP-seq
MIRT2616477	hsa-miR-4685-3p	CLIP-seq
MIRT2616478	hsa-miR-4685-5p	CLIP-seq
MIRT2616479	hsa-miR-4694-5p	CLIP-seq
MIRT2616480	hsa-miR-4757-5p	CLIP-seq
MIRT2616481	hsa-miR-4766-5p	CLIP-seq
MIRT2616482	hsa-miR-4780	CLIP-seq
MIRT2616483	hsa-miR-4789-3p	CLIP-seq
MIRT2616484	hsa-miR-4802-3p	CLIP-seq
MIRT2616486	hsa-miR-519d	CLIP-seq
MIRT2616488	hsa-miR-543	CLIP-seq
MIRT2616489	hsa-miR-548a-5p	CLIP-seq
MIRT2616490	hsa-miR-548ab	CLIP-seq
MIRT2616491	hsa-miR-548ak	CLIP-seq
MIRT2616492	hsa-miR-548b-5p	CLIP-seq
MIRT2690112	hsa-miR-548c-3p	CLIP-seq
MIRT2616493	hsa-miR-548c-5p	CLIP-seq
MIRT2616494	hsa-miR-548d-5p	CLIP-seq
MIRT2616495	hsa-miR-548h	CLIP-seq
MIRT2616496	hsa-miR-548i	CLIP-seq
MIRT2616497	hsa-miR-548j	CLIP-seq
MIRT2616498	hsa-miR-548k	CLIP-seq
MIRT2616499	hsa-miR-548l	CLIP-seq
MIRT2616500	hsa-miR-548n	CLIP-seq
MIRT2616501	hsa-miR-548t	CLIP-seq
MIRT2616502	hsa-miR-548w	CLIP-seq
MIRT2616503	hsa-miR-548y	CLIP-seq
MIRT2616504	hsa-miR-559	CLIP-seq
MIRT2616505	hsa-miR-561	CLIP-seq
MIRT2616506	hsa-miR-579	CLIP-seq
MIRT2616508	hsa-miR-623	CLIP-seq
MIRT2616510	hsa-miR-93	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT3	Activation	21102457

Show/Hide all (68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001664	Function	G protein-coupled receptor binding	IPI	24851274
GO:0001955	Process	Blood vessel maturation	IEA
GO:0001955	Process	Blood vessel maturation	ISS
GO:0003245	Process	Cardiac muscle tissue growth involved in heart morphogenesis	IEA
GO:0003245	Process	Cardiac muscle tissue growth involved in heart morphogenesis	ISS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IBA
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IDA	22344443
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8626678
GO:0005515	Function	Protein binding	IPI	16525420
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22344443
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8626678
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	ISS
GO:0007155	Process	Cell adhesion	TAS	9488656, 10555146
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8626678
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	ISS
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0030500	Process	Regulation of bone mineralization	ISS
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IBA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IDA	22344443
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045124	Process	Regulation of bone resorption	IEA
GO:0045124	Process	Regulation of bone resorption	ISS
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046625	Function	Sphingolipid binding	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050927	Process	Positive regulation of positive chemotaxis	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0061384	Process	Heart trabecula morphogenesis	IEA
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0072678	Process	T cell migration	IDA	20829352
GO:0072678	Process	T cell migration	IDA	37039481
GO:0072678	Process	T cell migration	IEA
GO:0072678	Process	T cell migration	ISS
GO:0098793	Component	Presynapse	IEA

MIM	HGNC	e!Ensembl
601974	3165	ENSG00000170989

P21453

Protein name

Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363)

Protein function

G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays

PDB

3V2W , 3V2Y , 7EO2 , 7EO4 , 7EVY , 7EVZ , 7EW0 , 7EW7 , 7TD3 , 7TD4 , 7VIE , 7VIF , 7VIG , 7VIH , 7WF7 , 8G94 , 8YIC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	62 → 311	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.

Sequence

MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS

Sequence length

382

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Sphingolipid signaling pathway Neuroactive ligand-receptor interaction Efferocytosis		G alpha (i) signalling events Lysosphingolipid and LPA receptors Interleukin-4 and Interleukin-13 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Stimulate	34552206	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	23111975, 31558162, 32384511, 32799825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	33788842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Associate	30889317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	16508938, 18658144, 22326262	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	20624651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Stimulate	18765664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	23674616, 31968593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	24387768	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Associate	31935914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	20889557, 24263101, 28121348, 28224210, 29923327, 31935914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	32799825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	32799825, 34301921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	27556509, 34301921, 36068200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	32799825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Associate	37882753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Associate	30836997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	35563301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24972972, 28121348, 31534132	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	36652045	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	31968593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Associate	33788842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Associate	37882753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	22480845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	22916176, 24751283	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Associate	22916176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	22277765, 32907751, 36524127	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	24903384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Stimulate	26887055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	17376432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Inhibit	36071219	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	22916176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	23419711, 28878352	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	22326262	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	19240180, 33788630	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	16508938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	16508938, 18209090, 22326262, 25496321, 29873694, 32889908, 33788842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Associate	30304001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	18477771, 36071219	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	25632006	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	30082521, 36380607	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	23028528, 37858140	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	27389057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	20081804, 25472725, 27061580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	20081804, 27224912, 29549086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Stimulate	22480845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	37882753, 38287231	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	34092610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	27405725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	24511991, 31968593, 32322257, 37882753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsies Progressive	Associate	23419711, 28878352	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	24972972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27556509, 31534132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18209090, 23419711, 24263101, 24972972, 25084322, 28224210, 30091994, 31359505, 32799825, 37828220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	30836997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	37828220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	24511991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Stimulate	25692679	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	20624651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	24387768	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Associate	15710622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	18209090	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Inhibit	20624651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	20624651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	30106120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Stimulate	27061580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Associate	25971967	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	34873055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	33788630	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Associate	19131156	★★★★★ ★☆☆☆☆ Found in Text Mining only

S1PR1 (sphingosine-1-phosphate receptor 1)