Gene Gene information from NCBI Gene database.
Entrez ID 1876
Gene name E2F transcription factor 6
Gene symbol E2F6
Synonyms (NCBI Gene)
E2F-6
Chromosome 2
Chromosome location 2p25.1
Summary This gene encodes a member of a family of transcription factors that play a crucial role in the control of the cell cycle. The protein encoded by this gene lacks the transactivation and tumor suppressor protein association domains found in other family me
miRNA miRNA information provided by mirtarbase database.
678
miRTarBase ID miRNA Experiments Reference
MIRT004726 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT005044 hsa-let-7b-5p Microarray 17699775
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
BRCA1 Repression 17096023
E2F1 Activation 16107498
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 9501179
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9501179
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9501179
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602944 3120 ENSG00000169016
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75461
Protein name Transcription factor E2F6 (E2F-6)
Protein function Inhibitor of E2F-dependent transcription (PubMed:9501179, PubMed:9689056, PubMed:9704927). Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' (PubMed:9501179). Has a preference for the 5'-TTTCCCGC-3' E2F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 64 128 E2F/DP family winged-helix DNA-binding domain Domain
PF16421 E2F_CC-MB 143 237 E2F transcription factor CC-MB domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen. {ECO:0000269|PubMed:9689056}.
Sequence
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIG
SDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCE
VEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN
Sequence length 281
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex   G1/S-Specific Transcription
Transcriptional Regulation by E2F6