Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1875
Gene name Gene Name - the full gene name approved by the HGNC.
E2F transcription factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
E2F5
Synonyms (NCBI Gene) Gene synonyms aliases
E2F-5
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000750 hsa-miR-34a-5p Review, Microarray 19461653
MIRT000750 hsa-miR-34a-5p Review, Microarray 19461653
MIRT003321 hsa-miR-205-5p Review 20026422
MIRT004134 hsa-miR-192-5p Microarray 16822819
MIRT003833 hsa-let-7b-5p Microarray 17699775
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600967 3119 ENSG00000133740
Protein
UniProt ID Q15329
Protein name Transcription factor E2F5 (E2F-5)
Protein function Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction. It is likely involved in the ear
PDB 5TUV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 51 116 E2F/DP family winged-helix DNA-binding domain Domain
PF16421 E2F_CC-MB 133 230 E2F transcription factor CC-MB domain Domain
Sequence
MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTT
KFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKG
VGAG
CNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN
CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLIN
KESSSSKPVV
FPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG
DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY
Sequence length 346
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Cellular senescence
TGF-beta signaling pathway
  Transcription of E2F targets under negative control by DREAM complex
G0 and Early G1
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Tremor Essential tremor N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brain Neoplasms Stimulate 33381564
Breast Neoplasms Associate 19259095, 31557971
Calcinosis Cutis Associate 27662660
Carcinoma Hepatocellular Stimulate 21274376
Carcinoma Hepatocellular Associate 24574752
Carcinoma Ovarian Epithelial Associate 20181230
Colorectal Neoplasms Associate 27058418, 29986714, 31173286
Esophageal Squamous Cell Carcinoma Associate 31983127
Glioblastoma Associate 29509253, 37567906
Glioma Associate 29362021, 33381564