Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1875
Gene name Gene Name - the full gene name approved by the HGNC.	E2F transcription factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	E2F5
Synonyms (NCBI Gene) Gene synonyms aliases	E2F-5
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN

Show/Hide all(263)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000750	hsa-miR-34a-5p	Review, Microarray	19461653
MIRT000750	hsa-miR-34a-5p	Review, Microarray	19461653
MIRT003321	hsa-miR-205-5p	Review	20026422
MIRT004134	hsa-miR-192-5p	Microarray	16822819
MIRT003833	hsa-let-7b-5p	Microarray	17699775
MIRT017999	hsa-miR-335-5p	Microarray	18185580
MIRT002917	hsa-miR-124-3p	Microarray	18668037
MIRT023808	hsa-miR-1-3p	Microarray	18668037
MIRT003321	hsa-miR-205-5p	Reporter assay	21454583
MIRT043926	hsa-miR-378a-3p	CLASH	23622248
MIRT053530	hsa-miR-106b-5p	qRT-PCR, Western blot	23803041
MIRT054422	hsa-miR-181a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24529171
MIRT054422	hsa-miR-181a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24529171
MIRT053530	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT173112	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT225969	hsa-let-7c-5p	3'LIFE	25074381
MIRT053530	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT173111	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT173123	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT173113	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT173131	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT173112	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT225969	hsa-let-7c-5p	3'LIFE	25074381
MIRT225973	hsa-miR-98-5p	qRT-PCR, Luciferase reporter assay, Immunofluorescence, Immunoprecipitaion, Western blot	25422988
MIRT732813	hsa-miR-584-5p	PAR-CLIP	27292025
MIRT732813	hsa-miR-584-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32420810
MIRT736700	hsa-miR-544a	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31579422
MIRT003321	hsa-miR-205-5p	Microarray, qRT-PCR	35816043
MIRT950630	hsa-let-7a	CLIP-seq
MIRT950631	hsa-let-7b	CLIP-seq
MIRT950632	hsa-let-7c	CLIP-seq
MIRT950633	hsa-let-7d	CLIP-seq
MIRT950634	hsa-let-7e	CLIP-seq
MIRT950635	hsa-let-7f	CLIP-seq
MIRT950636	hsa-let-7g	CLIP-seq
MIRT950637	hsa-let-7i	CLIP-seq
MIRT950638	hsa-miR-1	CLIP-seq
MIRT950639	hsa-miR-106a	CLIP-seq
MIRT950640	hsa-miR-106b	CLIP-seq
MIRT950641	hsa-miR-124	CLIP-seq
MIRT950642	hsa-miR-132	CLIP-seq
MIRT950643	hsa-miR-17	CLIP-seq
MIRT950644	hsa-miR-206	CLIP-seq
MIRT950645	hsa-miR-20a	CLIP-seq
MIRT950646	hsa-miR-20b	CLIP-seq
MIRT950647	hsa-miR-212	CLIP-seq
MIRT950648	hsa-miR-302a	CLIP-seq
MIRT950649	hsa-miR-302b	CLIP-seq
MIRT950650	hsa-miR-302c	CLIP-seq
MIRT950651	hsa-miR-302d	CLIP-seq
MIRT950652	hsa-miR-302e	CLIP-seq
MIRT950653	hsa-miR-3065-5p	CLIP-seq
MIRT950654	hsa-miR-3609	CLIP-seq
MIRT950655	hsa-miR-3653	CLIP-seq
MIRT950656	hsa-miR-3658	CLIP-seq
MIRT950657	hsa-miR-3662	CLIP-seq
MIRT950658	hsa-miR-3673	CLIP-seq
MIRT950659	hsa-miR-3689a-5p	CLIP-seq
MIRT950660	hsa-miR-3689b	CLIP-seq
MIRT950661	hsa-miR-3689e	CLIP-seq
MIRT950662	hsa-miR-3689f	CLIP-seq
MIRT950663	hsa-miR-372	CLIP-seq
MIRT950664	hsa-miR-373	CLIP-seq
MIRT950665	hsa-miR-3927	CLIP-seq
MIRT950666	hsa-miR-3935	CLIP-seq
MIRT950667	hsa-miR-3941	CLIP-seq
MIRT950668	hsa-miR-4458	CLIP-seq
MIRT950669	hsa-miR-4500	CLIP-seq
MIRT950670	hsa-miR-466	CLIP-seq
MIRT950671	hsa-miR-4672	CLIP-seq
MIRT950672	hsa-miR-4698	CLIP-seq
MIRT950673	hsa-miR-4796-3p	CLIP-seq
MIRT950674	hsa-miR-505	CLIP-seq
MIRT950675	hsa-miR-506	CLIP-seq
MIRT950676	hsa-miR-513b	CLIP-seq
MIRT950677	hsa-miR-519d	CLIP-seq
MIRT950678	hsa-miR-520a-3p	CLIP-seq
MIRT950679	hsa-miR-520b	CLIP-seq
MIRT950680	hsa-miR-520c-3p	CLIP-seq
MIRT950681	hsa-miR-520d-3p	CLIP-seq
MIRT950682	hsa-miR-520e	CLIP-seq
MIRT950683	hsa-miR-548ah	CLIP-seq
MIRT950684	hsa-miR-577	CLIP-seq
MIRT950685	hsa-miR-587	CLIP-seq
MIRT950686	hsa-miR-613	CLIP-seq
MIRT950687	hsa-miR-877	CLIP-seq
MIRT950688	hsa-miR-93	CLIP-seq
MIRT950689	hsa-miR-98	CLIP-seq
MIRT950690	hsa-miR-1271	CLIP-seq
MIRT950691	hsa-miR-154	CLIP-seq
MIRT950655	hsa-miR-3653	CLIP-seq
MIRT950656	hsa-miR-3658	CLIP-seq
MIRT950657	hsa-miR-3662	CLIP-seq
MIRT950667	hsa-miR-3941	CLIP-seq
MIRT950692	hsa-miR-4477a	CLIP-seq
MIRT950693	hsa-miR-4528	CLIP-seq
MIRT950670	hsa-miR-466	CLIP-seq
MIRT950671	hsa-miR-4672	CLIP-seq
MIRT950694	hsa-miR-495	CLIP-seq
MIRT950695	hsa-miR-548ac	CLIP-seq
MIRT950696	hsa-miR-548ae	CLIP-seq
MIRT950697	hsa-miR-548aj	CLIP-seq
MIRT950698	hsa-miR-548am	CLIP-seq
MIRT950699	hsa-miR-548d-3p	CLIP-seq
MIRT950700	hsa-miR-548x	CLIP-seq
MIRT950701	hsa-miR-548z	CLIP-seq
MIRT950702	hsa-miR-664	CLIP-seq
MIRT950703	hsa-miR-96	CLIP-seq
MIRT950641	hsa-miR-124	CLIP-seq
MIRT1981572	hsa-miR-1261	CLIP-seq
MIRT1981573	hsa-miR-186	CLIP-seq
MIRT1981574	hsa-miR-3133	CLIP-seq
MIRT1981575	hsa-miR-3162-5p	CLIP-seq
MIRT1981576	hsa-miR-34a	CLIP-seq
MIRT1981577	hsa-miR-34c-5p	CLIP-seq
MIRT1981578	hsa-miR-3611	CLIP-seq
MIRT1981579	hsa-miR-449a	CLIP-seq
MIRT1981580	hsa-miR-449b	CLIP-seq
MIRT1981581	hsa-miR-4719	CLIP-seq
MIRT950675	hsa-miR-506	CLIP-seq
MIRT950676	hsa-miR-513b	CLIP-seq
MIRT1981582	hsa-miR-548l	CLIP-seq
MIRT1981583	hsa-miR-758	CLIP-seq
MIRT950630	hsa-let-7a	CLIP-seq
MIRT950631	hsa-let-7b	CLIP-seq
MIRT950632	hsa-let-7c	CLIP-seq
MIRT950633	hsa-let-7d	CLIP-seq
MIRT950634	hsa-let-7e	CLIP-seq
MIRT950635	hsa-let-7f	CLIP-seq
MIRT950636	hsa-let-7g	CLIP-seq
MIRT950637	hsa-let-7i	CLIP-seq
MIRT950638	hsa-miR-1	CLIP-seq
MIRT950639	hsa-miR-106a	CLIP-seq
MIRT950640	hsa-miR-106b	CLIP-seq
MIRT950641	hsa-miR-124	CLIP-seq
MIRT2216558	hsa-miR-1256	CLIP-seq
MIRT950642	hsa-miR-132	CLIP-seq
MIRT950643	hsa-miR-17	CLIP-seq
MIRT2216559	hsa-miR-181a	CLIP-seq
MIRT2216560	hsa-miR-181b	CLIP-seq
MIRT2216561	hsa-miR-181c	CLIP-seq
MIRT2216562	hsa-miR-181d	CLIP-seq
MIRT2216563	hsa-miR-205	CLIP-seq
MIRT2216564	hsa-miR-2053	CLIP-seq
MIRT950644	hsa-miR-206	CLIP-seq
MIRT950645	hsa-miR-20a	CLIP-seq
MIRT950646	hsa-miR-20b	CLIP-seq
MIRT950647	hsa-miR-212	CLIP-seq
MIRT950648	hsa-miR-302a	CLIP-seq
MIRT950649	hsa-miR-302b	CLIP-seq
MIRT950650	hsa-miR-302c	CLIP-seq
MIRT950651	hsa-miR-302d	CLIP-seq
MIRT950652	hsa-miR-302e	CLIP-seq
MIRT950653	hsa-miR-3065-5p	CLIP-seq
MIRT1981576	hsa-miR-34a	CLIP-seq
MIRT1981577	hsa-miR-34c-5p	CLIP-seq
MIRT950654	hsa-miR-3609	CLIP-seq
MIRT950657	hsa-miR-3662	CLIP-seq
MIRT950658	hsa-miR-3673	CLIP-seq
MIRT950659	hsa-miR-3689a-5p	CLIP-seq
MIRT950660	hsa-miR-3689b	CLIP-seq
MIRT950661	hsa-miR-3689e	CLIP-seq
MIRT950662	hsa-miR-3689f	CLIP-seq
MIRT950663	hsa-miR-372	CLIP-seq
MIRT950664	hsa-miR-373	CLIP-seq
MIRT950665	hsa-miR-3927	CLIP-seq
MIRT950666	hsa-miR-3935	CLIP-seq
MIRT950667	hsa-miR-3941	CLIP-seq
MIRT2216565	hsa-miR-4262	CLIP-seq
MIRT2216566	hsa-miR-4276	CLIP-seq
MIRT2216567	hsa-miR-4420	CLIP-seq
MIRT2216568	hsa-miR-4438	CLIP-seq
MIRT950668	hsa-miR-4458	CLIP-seq
MIRT2216569	hsa-miR-4496	CLIP-seq
MIRT1981579	hsa-miR-449a	CLIP-seq
MIRT1981580	hsa-miR-449b	CLIP-seq
MIRT950669	hsa-miR-4500	CLIP-seq
MIRT950693	hsa-miR-4528	CLIP-seq
MIRT950670	hsa-miR-466	CLIP-seq
MIRT950671	hsa-miR-4672	CLIP-seq
MIRT2216570	hsa-miR-4694-5p	CLIP-seq
MIRT950672	hsa-miR-4698	CLIP-seq
MIRT1981581	hsa-miR-4719	CLIP-seq
MIRT950673	hsa-miR-4796-3p	CLIP-seq
MIRT2216571	hsa-miR-494	CLIP-seq
MIRT950674	hsa-miR-505	CLIP-seq
MIRT950675	hsa-miR-506	CLIP-seq
MIRT2216572	hsa-miR-5095	CLIP-seq
MIRT950676	hsa-miR-513b	CLIP-seq
MIRT950677	hsa-miR-519d	CLIP-seq
MIRT950678	hsa-miR-520a-3p	CLIP-seq
MIRT950679	hsa-miR-520b	CLIP-seq
MIRT950680	hsa-miR-520c-3p	CLIP-seq
MIRT950681	hsa-miR-520d-3p	CLIP-seq
MIRT950682	hsa-miR-520e	CLIP-seq
MIRT950683	hsa-miR-548ah	CLIP-seq
MIRT2216573	hsa-miR-548c-3p	CLIP-seq
MIRT2216574	hsa-miR-569	CLIP-seq
MIRT950684	hsa-miR-577	CLIP-seq
MIRT950685	hsa-miR-587	CLIP-seq
MIRT950686	hsa-miR-613	CLIP-seq
MIRT950702	hsa-miR-664	CLIP-seq
MIRT950687	hsa-miR-877	CLIP-seq
MIRT950688	hsa-miR-93	CLIP-seq
MIRT950689	hsa-miR-98	CLIP-seq
MIRT950630	hsa-let-7a	CLIP-seq
MIRT950631	hsa-let-7b	CLIP-seq
MIRT950632	hsa-let-7c	CLIP-seq
MIRT950633	hsa-let-7d	CLIP-seq
MIRT950634	hsa-let-7e	CLIP-seq
MIRT950635	hsa-let-7f	CLIP-seq
MIRT950636	hsa-let-7g	CLIP-seq
MIRT950637	hsa-let-7i	CLIP-seq
MIRT950638	hsa-miR-1	CLIP-seq
MIRT950642	hsa-miR-132	CLIP-seq
MIRT950644	hsa-miR-206	CLIP-seq
MIRT950647	hsa-miR-212	CLIP-seq
MIRT950653	hsa-miR-3065-5p	CLIP-seq
MIRT950657	hsa-miR-3662	CLIP-seq
MIRT950658	hsa-miR-3673	CLIP-seq
MIRT950659	hsa-miR-3689a-5p	CLIP-seq
MIRT950660	hsa-miR-3689b	CLIP-seq
MIRT950661	hsa-miR-3689e	CLIP-seq
MIRT950662	hsa-miR-3689f	CLIP-seq
MIRT950665	hsa-miR-3927	CLIP-seq
MIRT950666	hsa-miR-3935	CLIP-seq
MIRT950667	hsa-miR-3941	CLIP-seq
MIRT950668	hsa-miR-4458	CLIP-seq
MIRT950669	hsa-miR-4500	CLIP-seq
MIRT950670	hsa-miR-466	CLIP-seq
MIRT950671	hsa-miR-4672	CLIP-seq
MIRT950672	hsa-miR-4698	CLIP-seq
MIRT950674	hsa-miR-505	CLIP-seq
MIRT950684	hsa-miR-577	CLIP-seq
MIRT950686	hsa-miR-613	CLIP-seq
MIRT950687	hsa-miR-877	CLIP-seq
MIRT950689	hsa-miR-98	CLIP-seq
MIRT2216566	hsa-miR-4276	CLIP-seq
MIRT2216570	hsa-miR-4694-5p	CLIP-seq
MIRT2216566	hsa-miR-4276	CLIP-seq
MIRT2216570	hsa-miR-4694-5p	CLIP-seq
MIRT950638	hsa-miR-1	CLIP-seq
MIRT1981572	hsa-miR-1261	CLIP-seq
MIRT2216563	hsa-miR-205	CLIP-seq
MIRT950644	hsa-miR-206	CLIP-seq
MIRT2520452	hsa-miR-3154	CLIP-seq
MIRT1981576	hsa-miR-34a	CLIP-seq
MIRT1981577	hsa-miR-34c-5p	CLIP-seq
MIRT950658	hsa-miR-3673	CLIP-seq
MIRT2216568	hsa-miR-4438	CLIP-seq
MIRT2216569	hsa-miR-4496	CLIP-seq
MIRT1981579	hsa-miR-449a	CLIP-seq
MIRT1981580	hsa-miR-449b	CLIP-seq
MIRT950673	hsa-miR-4796-3p	CLIP-seq
MIRT2216571	hsa-miR-494	CLIP-seq
MIRT2216572	hsa-miR-5095	CLIP-seq
MIRT950686	hsa-miR-613	CLIP-seq
MIRT950638	hsa-miR-1	CLIP-seq
MIRT950644	hsa-miR-206	CLIP-seq
MIRT950658	hsa-miR-3673	CLIP-seq
MIRT2216569	hsa-miR-4496	CLIP-seq
MIRT950673	hsa-miR-4796-3p	CLIP-seq
MIRT950686	hsa-miR-613	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	17062573
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	7892279
GO:0005515	Function	Protein binding	IPI	12502741, 16360038, 17062573, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA

MIM	HGNC	e!Ensembl
600967	3119	ENSG00000133740

Protein

UniProt ID

Q15329

Protein name

Transcription factor E2F5 (E2F-5)

Protein function

Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction. It is likely involved in the ear

PDB

5TUV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02319	E2F_TDP	51 → 116	E2F/DP family winged-helix DNA-binding domain	Domain
PF16421	E2F_CC-MB	133 → 230	E2F transcription factor CC-MB domain	Domain

Sequence

MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTT
KFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAG
CNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN
CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVV
FPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG
DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY

Sequence length

346

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Cellular senescence TGF-beta signaling pathway		Transcription of E2F targets under negative control by DREAM complex G0 and Early G1 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Cyclin E associated events during G1/S transition G1/S-Specific Transcription Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Tremor	Essential tremor	N/A	N/A	GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Brain Neoplasms	Stimulate	33381564
Breast Neoplasms	Associate	19259095, 31557971
Calcinosis Cutis	Associate	27662660
Carcinoma Hepatocellular	Stimulate	21274376
Carcinoma Hepatocellular	Associate	24574752
Carcinoma Ovarian Epithelial	Associate	20181230
Colorectal Neoplasms	Associate	27058418, 29986714, 31173286
Esophageal Squamous Cell Carcinoma	Associate	31983127
Glioblastoma	Associate	29509253, 37567906
Glioma	Associate	29362021, 33381564
Melanoma	Associate	10727462, 21454583
Neoplasm Metastasis	Associate	31557971
Neoplasms	Associate	16721044, 19259095, 20181230, 25646628, 31983127
Neoplasms	Stimulate	33381564
Ovarian Neoplasms	Associate	30392041
Pancreatic Neoplasms	Associate	35985439
Prostatic Neoplasms	Stimulate	39473405
Prostatitis	Associate	33390186
Retinoblastoma	Associate	28351331, 35909488
Squamous Cell Carcinoma of Head and Neck	Associate	36855110
Stomach Neoplasms	Associate	23803041, 25646628, 30487158

E2F5 (E2F transcription factor 5)