Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1870
Gene name Gene Name - the full gene name approved by the HGNC.
E2F transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
E2F2
Synonyms (NCBI Gene) Gene synonyms aliases
E2F-2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001126 hsa-miR-98-5p Northern blot 19528081
MIRT001126 hsa-miR-98-5p Western blot 19528081
MIRT001126 hsa-miR-98-5p qRT-PCR 19528081
MIRT001126 hsa-miR-98-5p ChIP 19528081
MIRT001126 hsa-miR-98-5p Luciferase reporter assay 19528081
Transcription factors
Transcription factor Regulation Reference
RB1 Repression 9671466
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7739537
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600426 3114 ENSG00000007968
Protein
UniProt ID Q14209
Protein name Transcription factor E2F2 (E2F-2)
Protein function Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication
PDB 1N4M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 130 194 E2F/DP family winged-helix DNA-binding domain Domain
PF16421 E2F_CC-MB 210 304 E2F transcription factor CC-MB domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
Sequence
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVG
RGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCP
EEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
Sequence length 437
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance
Cell cycle
Cellular senescence
Cushing syndrome
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
  Oxidative Stress Induced Senescence
Oncogene Induced Senescence
CDC6 association with the ORC:origin complex
Cyclin D associated events in G1
<