Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1869
Gene name Gene Name - the full gene name approved by the HGNC.	E2F transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	E2F1
Synonyms (NCBI Gene) Gene synonyms aliases	E2F-1, RBAP1, RBBP3, RBP3
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN

Show/Hide all(326)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay	18676839
MIRT003045	hsa-miR-106b-5p	qRT-PCR	18676839
MIRT001191	hsa-miR-21-5p	qRT-PCR, Western blot	19906824
MIRT001124	hsa-miR-98-5p	Luciferase reporter assay	19528081
MIRT001191	hsa-miR-21-5p	Luciferase reporter assay	19528081
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay, Western blot	19597470
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay, Western blot	19597470
MIRT000632	hsa-miR-223-3p	Luciferase reporter assay, Western blot	20029046
MIRT000632	hsa-miR-223-3p	Luciferase reporter assay, Western blot	20029046
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay	19597470
MIRT003045	hsa-miR-106b-5p	Review	19815577
MIRT002472	hsa-miR-93-5p	Review	19815577
MIRT003424	hsa-miR-23b-3p	flow, Microarray	20133741
MIRT003322	hsa-miR-205-5p	Review	20026422
MIRT000374	hsa-miR-106a-5p	Immunohistochemistry, Microarray, Western blot	20643754
MIRT004821	hsa-miR-34a-5p	Immunoblot, Immunohistochemistry, qRT-PCR	17875987
MIRT002935	hsa-miR-17-5p	qRT-PCR	18521848
MIRT000374	hsa-miR-106a-5p	qRT-PCR	18521848
MIRT005020	hsa-miR-126-3p	qRT-PCR	18521848
MIRT000180	hsa-miR-20a-5p	Western blot	18836483
MIRT002935	hsa-miR-17-5p	Western blot	18836483
MIRT005356	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005356	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Northern blot, qRT-PCR, Western blot	16940181
MIRT000180	hsa-miR-20a-5p	Western blot	19110058
MIRT003904	hsa-let-7a-5p	Western blot	19110058
MIRT000180	hsa-miR-20a-5p	Western blot	18025036
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	19486339
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Western blot	19486339
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT016529	hsa-miR-193b-3p	Microarray	20304954
MIRT020292	hsa-miR-130b-3p	Sequencing	20371350
MIRT003045	hsa-miR-106b-5p	Reporter assay	18212054
MIRT005356	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR;Other	20623644
MIRT003322	hsa-miR-205-5p	Reporter assay	21454583
MIRT004821	hsa-miR-34a-5p	Western blot	21128241
MIRT002472	hsa-miR-93-5p	Sequencing	20371350
MIRT030626	hsa-miR-24-3p	qRT-PCR	19748357
MIRT000180	hsa-miR-20a-5p	Reporter assay	15944709
MIRT002935	hsa-miR-17-5p	Reporter assay	15944709
MIRT035553	hsa-miR-181b-5p	Luciferase reporter assay, Western blot	23083446
MIRT035553	hsa-miR-181b-5p	Luciferase reporter assay, Western blot	23083446
MIRT047521	hsa-miR-10a-5p	CLASH	23622248
MIRT035553	hsa-miR-181b-5p	CLASH	23622248
MIRT000180	hsa-miR-20a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23868977
MIRT002935	hsa-miR-17-5p	qRT-PCR	24901013
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	20371350
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	20371350
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT083347	hsa-miR-4283	PAR-CLIP	20371350
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT003045	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000180	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT003045	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT002935	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727824	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT002472	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727823	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT000180	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT004821	hsa-miR-34a-5p	qRT-PCR, Western blot	27704360
MIRT004821	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28293146
MIRT004821	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28293146
MIRT727823	hsa-miR-519d-3p	Luciferase reporter assay	28146423
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay	27282946
MIRT000374	hsa-miR-106a-3p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-3p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-5p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-5p	RNA-seq	33037409
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33495833
MIRT727824	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32174776
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32174776
MIRT000718	hsa-miR-330-3p	qRT-PCR	32884568
MIRT737286	hsa-miR-92a-3p	Western blotting	32917956
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	20371350
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	20371350
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT083347	hsa-miR-4283	PAR-CLIP	20371350
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT755490	hsa-miR-1205	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	35994229
MIRT755768	hsa-miR-183-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35655310
MIRT003322	hsa-miR-205-5p	Microarray, qRT-PCR	35816043
MIRT950078	hsa-miR-1299	CLIP-seq
MIRT950079	hsa-miR-136	CLIP-seq
MIRT950080	hsa-miR-1976	CLIP-seq
MIRT950081	hsa-miR-2278	CLIP-seq
MIRT950082	hsa-miR-2355-5p	CLIP-seq
MIRT950083	hsa-miR-3138	CLIP-seq
MIRT950084	hsa-miR-3150b-3p	CLIP-seq
MIRT950085	hsa-miR-3151	CLIP-seq
MIRT950086	hsa-miR-3192	CLIP-seq
MIRT950087	hsa-miR-320a	CLIP-seq
MIRT950088	hsa-miR-320b	CLIP-seq
MIRT950089	hsa-miR-320c	CLIP-seq
MIRT950090	hsa-miR-320d	CLIP-seq
MIRT950091	hsa-miR-329	CLIP-seq
MIRT950092	hsa-miR-3679-3p	CLIP-seq
MIRT950093	hsa-miR-3689a-3p	CLIP-seq
MIRT950094	hsa-miR-3689c	CLIP-seq
MIRT950095	hsa-miR-3929	CLIP-seq
MIRT950096	hsa-miR-3941	CLIP-seq
MIRT950097	hsa-miR-3945	CLIP-seq
MIRT950098	hsa-miR-4253	CLIP-seq
MIRT950099	hsa-miR-4276	CLIP-seq
MIRT950100	hsa-miR-4419b	CLIP-seq
MIRT950101	hsa-miR-4429	CLIP-seq
MIRT950102	hsa-miR-4434	CLIP-seq
MIRT950103	hsa-miR-4438	CLIP-seq
MIRT950104	hsa-miR-4478	CLIP-seq
MIRT950105	hsa-miR-4491	CLIP-seq
MIRT950106	hsa-miR-4505	CLIP-seq
MIRT950107	hsa-miR-4516	CLIP-seq
MIRT950108	hsa-miR-4519	CLIP-seq
MIRT950109	hsa-miR-4531	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT950111	hsa-miR-4657	CLIP-seq
MIRT950112	hsa-miR-4667-3p	CLIP-seq
MIRT950113	hsa-miR-4705	CLIP-seq
MIRT950114	hsa-miR-4722-3p	CLIP-seq
MIRT950115	hsa-miR-4728-5p	CLIP-seq
MIRT950116	hsa-miR-4782-5p	CLIP-seq
MIRT950117	hsa-miR-4784	CLIP-seq
MIRT950118	hsa-miR-4800-5p	CLIP-seq
MIRT950119	hsa-miR-486-3p	CLIP-seq
MIRT950120	hsa-miR-491-5p	CLIP-seq
MIRT950121	hsa-miR-493	CLIP-seq
MIRT950122	hsa-miR-516b	CLIP-seq
MIRT950123	hsa-miR-548ac	CLIP-seq
MIRT950124	hsa-miR-548d-3p	CLIP-seq
MIRT950125	hsa-miR-548z	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT950127	hsa-miR-885-5p	CLIP-seq
MIRT950128	hsa-miR-939	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981435	hsa-miR-1258	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT950081	hsa-miR-2278	CLIP-seq
MIRT1981439	hsa-miR-3973	CLIP-seq
MIRT1981440	hsa-miR-4418	CLIP-seq
MIRT1981441	hsa-miR-4459	CLIP-seq
MIRT1981442	hsa-miR-4476	CLIP-seq
MIRT950108	hsa-miR-4519	CLIP-seq
MIRT1981443	hsa-miR-4722-5p	CLIP-seq
MIRT1981444	hsa-miR-4779	CLIP-seq
MIRT950120	hsa-miR-491-5p	CLIP-seq
MIRT1981445	hsa-miR-509-3-5p	CLIP-seq
MIRT1981446	hsa-miR-509-5p	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT1981451	hsa-miR-520g	CLIP-seq
MIRT1981452	hsa-miR-520h	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq
MIRT950128	hsa-miR-939	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT2216457	hsa-miR-181a	CLIP-seq
MIRT2216458	hsa-miR-181b	CLIP-seq
MIRT2216459	hsa-miR-181c	CLIP-seq
MIRT2216460	hsa-miR-181d	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT2216461	hsa-miR-3649	CLIP-seq
MIRT2216462	hsa-miR-377	CLIP-seq
MIRT2216463	hsa-miR-4262	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq
MIRT950091	hsa-miR-329	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT950085	hsa-miR-3151	CLIP-seq
MIRT2448628	hsa-miR-3154	CLIP-seq
MIRT1981439	hsa-miR-3973	CLIP-seq
MIRT2448629	hsa-miR-4270	CLIP-seq
MIRT950102	hsa-miR-4434	CLIP-seq
MIRT2448630	hsa-miR-4441	CLIP-seq
MIRT2448631	hsa-miR-4443	CLIP-seq
MIRT950107	hsa-miR-4516	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT1981451	hsa-miR-520g	CLIP-seq
MIRT1981452	hsa-miR-520h	CLIP-seq
MIRT2448632	hsa-miR-564	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(35)

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
E2F1	Unknown	7958836
E2F6	Repression	18562691
E2F7	Repression	18202719
E2F8	Repression	18202719
ELL	Repression	24344198
ERCC2	Unknown	9400991
ESR1	Unknown	10446910;12697671
HCFC1	Activation	17612494;19763085
HDAC1	Repression	9724731
HES1	Repression	15467735
HIC1	Repression	19486893
IRF1	Repression	22200613
NFKB1	Unknown	16725311
NR0B2	Repression	18657049
NR2F2	Unknown	22734039
NR4A1	Activation	12947120
PA2G4	Repression	16254079
PA2G4	Unknown	17786317
PARP1	Activation	14627987
PAX8	Activation	21602887
PGR	Activation	20123965
POLR1A	Repression	21878508
RB1	Repression	12460790;1534305;21602887;9326598;9400991;9671466
RB1	Unknown	11939591;8575214
RELA	Unknown	16725311
RORA	Unknown	24891616
SIN3A	Repression	16254079
SP1	Unknown	10446910
TBP	Unknown	9400991
TFDP3	Unknown	23212661
TP53	Repression	8557038
TP73	Unknown	19363520
TRIM16	Repression	20729920
YBX1	Unknown	22205655

Show/Hide all(81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IMP	12717439
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20224733
GO:0000228	Component	Nuclear chromosome	IEA
GO:0000785	Component	Chromatin	IDA	21454377
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	20040599
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	15735762
GO:0001216	Function	DNA-binding transcription activator activity	IDA	17062573, 28992046
GO:0001216	Function	DNA-binding transcription activator activity	IEA
GO:0003677	Function	DNA binding	IDA	15073182, 15731768
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	11418595
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15731768
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	11418595
GO:0005515	Function	Protein binding	IPI	7784053, 8336704, 8657141, 9418871, 9468139, 9468140, 11418595, 11486038, 12502741, 14627987, 16061792, 16249186, 16360038, 16374512, 16892051, 17006541, 17062573, 17380128, 17517653, 17690688, 17704056, 18660514, 18660752, 18794899, 19188449, 19249677, 20040599, 20133863, 20195357
GO:0005634	Component	Nucleus	IDA	28992046
GO:0005634	Component	Nucleus	IDA	1531329, 12717439, 20040599
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006351	Process	DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	1531329, 12717439, 23934193
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IMP	12717439
GO:0010628	Process	Positive regulation of gene expression	IDA	15766563
GO:0019901	Function	Protein kinase binding	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032991	Component	Protein-containing complex	IDA	23629655
GO:0035189	Component	Rb-E2F complex	IBA
GO:0035189	Component	Rb-E2F complex	IDA	20224733
GO:0035189	Component	Rb-E2F complex	IPI	16360038
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15565177
GO:0043276	Process	Anoikis	IEA
GO:0043392	Process	Negative regulation of DNA binding	IDA	20176812
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20176812
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	21454377, 22476863
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	15565177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	28992046
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20040599, 20224733
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	20224733
GO:0048255	Process	MRNA stabilization	IDA	15766563
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	16360038
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0070345	Process	Negative regulation of fat cell proliferation	IEA
GO:0070345	Process	Negative regulation of fat cell proliferation	ISS
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	16360038
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16360038, 20176812
GO:1990086	Process	Lens fiber cell apoptotic process	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	20224733

MIM	HGNC	e!Ensembl
189971	3113	ENSG00000101412

Protein

UniProt ID

Q01094

Protein name

Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)

Protein function

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication

PDB

1H24 , 1O9K , 2AZE , 5M9N , 5M9O , 6G0P , 6ULS , 9CB3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02319	E2F_TDP	128 → 192	E2F/DP family winged-helix DNA-binding domain	Domain
PF16421	E2F_CC-MB	206 → 299	E2F transcription factor CC-MB domain	Domain

Sequence

MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF

Sequence length

437

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance Cell cycle Mitophagy - animal Cellular senescence Cushing syndrome Hepatitis C Hepatitis B Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Pathways in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Pancreatic cancer Glioma Prostate cancer Melanoma Bladder cancer Chronic myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer		Activation of NOXA and translocation to mitochondria Transcription of E2F targets under negative control by DREAM complex Activation of PUMA and translocation to mitochondria Pre-NOTCH Transcription and Translation Oxidative Stress Induced Senescence Oncogene Induced Senescence TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest CDC6 association with the ORC:origin complex G2 Phase Cyclin E associated events during G1/S transition G1/S-Specific Transcription Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry Transcriptional Regulation by E2F6 Transcriptional regulation of granulopoiesis

E2F1 (E2F transcription factor 1)