Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1861
Gene name Gene Name - the full gene name approved by the HGNC.
Torsin family 1 member A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TOR1A
Synonyms (NCBI Gene) Gene synonyms aliases
AMC5, DQ2, DYT1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1801968 C>G,T Risk-factor, likely-benign, benign Missense variant, coding sequence variant, non coding transcript variant
rs80358233 CTC>- Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, inframe deletion, non coding transcript variant
rs267607134 A>T Uncertain-significance, pathogenic, conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs727502811 C>T Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs760768475 G>A Likely-pathogenic Coding sequence variant, non coding transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051256 hsa-miR-16-5p CLASH 23622248
MIRT722992 hsa-miR-34b-3p HITS-CLIP 19536157
MIRT722991 hsa-miR-4289 HITS-CLIP 19536157
MIRT722990 hsa-miR-3120-5p HITS-CLIP 19536157
MIRT722989 hsa-miR-15b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000338 Process Protein deneddylation IMP 21102408
GO:0005515 Function Protein binding IPI 15147511, 15505207, 15767459, 18167355, 18827015, 21102408, 23569223, 25416956, 25910212, 32296183, 32814053, 33961781
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605204 3098 ENSG00000136827
Protein
UniProt ID O14656
Protein name Torsin-1A (Dystonia 1 protein) (Torsin ATPase-1A) (EC 3.6.4.-) (Torsin family 1 member A)
Protein function Protein with chaperone functions important for the control of protein folding, processing, stability and localization as well as for the reduction of misfolded protein aggregates. Involved in the regulation of synaptic vesicle recycling, control
PDB 5J1S , 5J1T , 6OIF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06309 Torsin 44 169 Torsin Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highest levels in kidney and liver. In the brain, high levels found in the dopaminergic neurons of the substantia nigra pars compacta, as well as in the neocortex, hippocampus and cerebellum. Also highly expressed in
Sequence
MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREA
LQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY
EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIF
DEMDKMHAGLI
DAIKPFLDYYDLVDGVSYQKAMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL
SVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRV
AEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cargo recognition for clathrin-mediated endocytosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Arthrogryposis multiplex congenita Arthrogryposis multiplex congenita 5 rs80358233, rs760768475 N/A
Dystonia Dystonic disorder rs80358233, rs760768475 N/A
Limb-Onset Dystonia early-onset generalized limb-onset dystonia rs80358233, rs760768475 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital finger flexion contractures Flexion contracture N/A N/A ClinVar
Prostate cancer Prostate cancer (early onset), Prostate cancer (advanced), Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 21515903
Adenoma Islet Cell Associate 8529124
Arachnoid Cysts Associate 36757831
Arthrogryposis Associate 36757831
Atherosclerosis Associate 29064046
Autistic Disorder Associate 31808517
Autoimmune Diseases Associate 21628452, 34579148
Autoimmune Diseases Stimulate 29182645
Benign essential blepharospasm Associate 19202559
Blepharospasm Associate 19202559