Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1852
Gene name Gene Name - the full gene name approved by the HGNC.	Dual specificity phosphatase 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DUSP9
Synonyms (NCBI Gene) Gene synonyms aliases	MKP-4, MKP4
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq28
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027506	hsa-miR-98-5p	Microarray	19088304
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT948390	hsa-miR-1252	CLIP-seq
MIRT948391	hsa-miR-186	CLIP-seq
MIRT948392	hsa-miR-3133	CLIP-seq
MIRT948393	hsa-miR-4504	CLIP-seq
MIRT948394	hsa-miR-452	CLIP-seq
MIRT948395	hsa-miR-4676-3p	CLIP-seq
MIRT948396	hsa-miR-4731-3p	CLIP-seq
MIRT948397	hsa-miR-4801	CLIP-seq
MIRT948398	hsa-miR-549	CLIP-seq
MIRT1548079	hsa-miR-3921	CLIP-seq
MIRT1548080	hsa-miR-4251	CLIP-seq
MIRT1548081	hsa-miR-4279	CLIP-seq
MIRT1548082	hsa-miR-4329	CLIP-seq
MIRT1548083	hsa-miR-4653-5p	CLIP-seq
MIRT1548084	hsa-miR-4786-5p	CLIP-seq
MIRT1548085	hsa-miR-769-5p	CLIP-seq
MIRT1981003	hsa-miR-1184	CLIP-seq
MIRT1981004	hsa-miR-1301	CLIP-seq
MIRT1981005	hsa-miR-3127-3p	CLIP-seq
MIRT1981006	hsa-miR-3138	CLIP-seq
MIRT1981007	hsa-miR-328	CLIP-seq
MIRT1981008	hsa-miR-3911	CLIP-seq
MIRT1981009	hsa-miR-4258	CLIP-seq
MIRT1981010	hsa-miR-4453	CLIP-seq
MIRT1981011	hsa-miR-4520a-3p	CLIP-seq
MIRT1981012	hsa-miR-4538	CLIP-seq
MIRT1981013	hsa-miR-4660	CLIP-seq
MIRT1981014	hsa-miR-4800-5p	CLIP-seq
MIRT1981015	hsa-miR-5047	CLIP-seq
MIRT2216133	hsa-miR-615-3p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS	9030581
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	11988087, 21908610, 27880917, 31980649, 32707033, 33961781
GO:0005634	Component	Nucleus	TAS	9030581
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9030581
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006470	Process	Protein dephosphorylation	TAS	9030581
GO:0007165	Process	Signal transduction	IBA
GO:0007254	Process	JNK cascade	TAS	9030581
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA
GO:0033550	Function	MAP kinase tyrosine phosphatase activity	IBA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA

MIM	HGNC	e!Ensembl
300134	3076	ENSG00000130829

Protein

UniProt ID

Q99956

Protein name

Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4)

Protein function

Inactivates MAP kinases. Has a specificity for the ERK family.

PDB

2HXP , 3LJ8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	7 → 133	Rhodanese-like domain	Domain
PF00782	DSPc	211 → 343	Dual specificity phosphatase, catalytic domain	Domain

Sequence

MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
SAASNPPSFFTTPTSDGAFELAPT

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Signaling pathways regulating pluripotency of stem cells		RAF-independent MAPK1/3 activation Negative regulation of MAPK pathway

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Renal Cell	Associate	21253009, 21943117
Colorectal Neoplasms	Associate	24838152, 28483913
Diabetes Gestational	Stimulate	31772940
Diabetes Mellitus Type 2	Associate	20581827, 22961080, 23029454
Inflammation	Associate	36980809
Insulin Resistance	Associate	31772940
Melanoma	Associate	35999349
Neoplasm Metastasis	Associate	32881299
Neoplasms	Associate	21253009, 24838152, 32881299
Obesity	Associate	36980809
Prediabetic State	Associate	36980809

DUSP9 (dual specificity phosphatase 9)