Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1843
Gene name Gene Name - the full gene name approved by the HGNC.	Dual specificity phosphatase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DUSP1
Synonyms (NCBI Gene) Gene synonyms aliases	CL100, HVH1, MKP-1, MKP1, PTPN10
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play

Show/Hide all(380)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005876	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21068409
MIRT005876	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21068409
MIRT028795	hsa-miR-26b-5p	Microarray	19088304
MIRT053465	hsa-miR-200c-3p	Microarray	23807165
MIRT438558	hsa-miR-146a-5p	qRT-PCR, Western blot	23825193
MIRT437985	hsa-miR-940	qRT-PCR, Microarray, Western blot	24675421
MIRT438558	hsa-miR-146a-5p	qRT-PCR, Western blot	23825193
MIRT437985	hsa-miR-940	qRT-PCR, Microarray, Western blot	24675421
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT053465	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	27696308
MIRT733967	hsa-miR-1468-3p	Flow cytometry, Luciferase reporter assay, RNA-seq, qRT-PCR, Western blotting	32348937
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947381	hsa-miR-1289	CLIP-seq
MIRT947382	hsa-miR-137	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947388	hsa-miR-203	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947390	hsa-miR-25	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947392	hsa-miR-3183	CLIP-seq
MIRT947393	hsa-miR-3198	CLIP-seq
MIRT947394	hsa-miR-32	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT947396	hsa-miR-33a	CLIP-seq
MIRT947397	hsa-miR-33b	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947399	hsa-miR-363	CLIP-seq
MIRT947400	hsa-miR-367	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947407	hsa-miR-4279	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT947409	hsa-miR-4294	CLIP-seq
MIRT947410	hsa-miR-4309	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT947415	hsa-miR-4723-3p	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT947418	hsa-miR-513c	CLIP-seq
MIRT947419	hsa-miR-514b-5p	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947422	hsa-miR-92a	CLIP-seq
MIRT947423	hsa-miR-92b	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2215665	hsa-miR-133a	CLIP-seq
MIRT2215666	hsa-miR-133b	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT2215672	hsa-miR-4281	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT2215673	hsa-miR-4301	CLIP-seq
MIRT2215674	hsa-miR-431	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT2215685	hsa-miR-603	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2428403	hsa-miR-3185	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT2428404	hsa-miR-4778-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT2436894	hsa-miR-1236	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2436895	hsa-miR-1913	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2436896	hsa-miR-3182	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT2436897	hsa-miR-324-3p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT2436898	hsa-miR-4727-5p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2436899	hsa-miR-4753-3p	CLIP-seq
MIRT2436900	hsa-miR-4758-3p	CLIP-seq
MIRT2436901	hsa-miR-4768-5p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
ATF2	Unknown	17681939
ATM	Activation	17178844
CREM	Repression	21325296
E2F1	Activation	17638884
PGR	Activation	22020934
STAT6	Unknown	18342537
TP53	Activation	12890671;15611668

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000188	Process	Inactivation of MAPK activity	IBA	21873635
GO:0000188	Process	Inactivation of MAPK activity	ISS
GO:0001706	Process	Endoderm formation	IBA	21873635
GO:0004721	Function	Phosphoprotein phosphatase activity	IBA	21873635
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	1406996
GO:0005515	Function	Protein binding	IPI	10617468, 16286470, 20347885, 20936779, 25241761
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	7593328
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	7593328
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0007162	Process	Negative regulation of cell adhesion	IMP	22991462
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA	21873635
GO:0009416	Process	Response to light stimulus	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	21873635
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS
GO:0019838	Function	Growth factor binding	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IBA	21873635
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	1406996
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035970	Process	Peptidyl-threonine dephosphorylation	IBA	21873635
GO:0035970	Process	Peptidyl-threonine dephosphorylation	ISS
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	7593328
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA	21873635
GO:0051019	Function	Mitogen-activated protein kinase binding	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051447	Process	Negative regulation of meiotic cell cycle	ISS
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0070262	Process	Peptidyl-serine dephosphorylation	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071850	Process	Mitotic cell cycle arrest	ISS
GO:0090027	Process	Negative regulation of monocyte chemotaxis	IMP	22991462
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	ISS
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA
GO:1903753	Process	Negative regulation of p38MAPK cascade	IBA	21873635
GO:1903753	Process	Negative regulation of p38MAPK cascade	IMP	22991462
GO:1990869	Process	Cellular response to chemokine	IMP	22991462
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
600714	3064	ENSG00000120129

Protein

UniProt ID

P28562

Protein name

Dual specificity protein phosphatase 1 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH1) (Mitogen-activated protein kinase phosphatase 1) (MAP kinase phosphatase 1) (MKP-1) (Protein-tyrosine phosphatase CL100)

Protein function

Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.

PDB

6APX , 6D65 , 6D66 , 6D67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	9 → 131	Rhodanese-like domain	Domain
PF00782	DSPc	181 → 311	Dual specificity phosphatase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney. {ECO:0000269|PubMed:8106404}.

Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Serotonergic synapse Parkinson disease Fluid shear stress and atherosclerosis		RAF-independent MAPK1/3 activation Negative regulation of MAPK pathway

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Endometriosis	Endometriosis	21063030	ClinVar
Mental depression	Mental Depression, Depressive disorder	25410305, 20953200, 23668904, 15496935, 22237309	ClinVar
Eczema	Eczema		GWAS
Glaucoma	Glaucoma		GWAS

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References
Associations from Text Mining
Acro Osteolysis	Associate	35145077
Adenocarcinoma	Associate	35713363
Airway Remodeling	Associate	23533638
Alzheimer Disease	Associate	36405736
Arteriosclerosis	Associate	35713363
Arthritis Psoriatic	Associate	27706699
Arthritis Rheumatoid	Associate	15476200
Ascites	Associate	17971902
Asthma	Associate	18492738, 18635892, 20673984, 22372570, 27852250
Asthma	Inhibit	23533638
Atherosclerosis	Associate	20353815
Breast Neoplasms	Associate	15590693, 22020934, 22333693, 25377473, 25774547, 26859151, 29422643, 30483784, 8909245
Bronchopulmonary Dysplasia	Associate	31330530
Carcinogenesis	Associate	8909245
Carcinoma	Inhibit	21960346
Carcinoma Endometrioid	Associate	27174322
Carcinoma Hepatocellular	Associate	29048612, 37903974, 39477468
Carcinoma Non Small Cell Lung	Associate	15173070, 26689986
Carcinoma Renal Cell	Associate	37503331
Carcinoma Squamous Cell	Associate	21960346
Cardiomyopathies	Inhibit	34512872
Cardiovascular Diseases	Associate	35713363
Cerebral Infarction	Associate	25135788, 31168961
Cerebral Infarction	Stimulate	37699956
Colitis Ulcerative	Associate	26461477
Colorectal Neoplasms	Associate	20234366, 24005240, 26461477
Corticosteroid Binding Globulin Deficiency	Associate	18492738
COVID 19	Inhibit	34303662
Diabetes Mellitus Type 1	Associate	35155683
Diabetic Nephropathies	Associate	36329882, 36466094, 36585417, 36919187, 37038746, 37554330
Drug Related Side Effects and Adverse Reactions	Associate	22222766, 24675421
Glioblastoma	Associate	31504251, 39946771
Glioma	Associate	19759012
Glomerulonephritis IGA	Associate	35910761, 38278877
Glomerulosclerosis Focal Segmental	Associate	35713363
Graves Ophthalmopathy	Associate	40065401
Heart Defects Congenital	Associate	25205790
Heart Failure	Associate	37334672
Hepatitis C Chronic	Associate	25798824
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19411256, 26859151
Hereditary leiomyomatosis and renal cell cancer	Associate	26160878
HIV Infections	Inhibit	24023646
Hodgkin Disease	Associate	26160878
Hypertension Pulmonary	Associate	31330530
Hypothermia	Associate	19596001
Hypoxia	Associate	10212278, 30967156, 34512872
Hypoxia	Stimulate	24267255
Hypoxia Brain	Stimulate	26160878, 37246768
Hypoxia Brain	Associate	34512872
Ichthyosis X Linked	Associate	34303662
Idiopathic Pulmonary Fibrosis	Associate	34831059
Infections	Associate	23097457
Infections	Stimulate	23871663
Inflammation	Associate	19880449, 20868379, 21060794, 22372570, 22726420, 24339725, 25370852, 26461477, 26634547, 27548147, 27706699, 30608978, 30967632, 35488446, 35713363 View all (6 more)
Inflammation	Inhibit	21827450, 23533638, 25724669, 26178144
Intervertebral Disc Degeneration	Associate	36814575
Ischemia	Stimulate	19032224
Ischemic Stroke	Associate	25135788
Jaundice Obstructive	Associate	27551049
Kidney Diseases	Associate	35713363
Klatskin Tumor	Associate	20145951
Leukemia Lymphocytic Chronic B Cell	Associate	37792532
Leukemia Myeloid Acute	Associate	37872685
Lichen Planus Oral	Associate	23892499
Lung Neoplasms	Associate	22222766
Melanoma	Associate	30925905, 35999349
Meningioma	Associate	32703768
Mitochondrial Diseases	Inhibit	34512872
Mitochondrial Diseases	Associate	37635488
Mouth Neoplasms	Associate	23892499
Multiple Myeloma	Associate	40077895
Mycobacterium Infections Nontuberculous	Associate	20017901
Myocardial Infarction	Associate	37334672
Neoplasm Metastasis	Associate	36142828
Neoplasms	Associate	10212278, 12890671, 15753082, 25774547, 29434446, 29956792, 31061093, 31164669, 32703768, 35704796, 35911442, 36596724, 37792582, 37872685
Neoplasms	Inhibit	23169297, 25537506, 29382334, 8909245
Neoplasms	Stimulate	27411053
Neoplasms Adipose Tissue	Associate	25370852
Neoplasms Germ Cell and Embryonal	Associate	27572311
Neuralgia	Associate	29672183
Non alcoholic Fatty Liver Disease	Associate	33603714, 36923221, 37721003
Nose Diseases	Associate	27050744
Obesity	Inhibit	18635892, 22606276
Obesity	Stimulate	25370852
Obesity	Associate	25370852, 36098275, 37721003
Osteoarthritis	Associate	30186872, 37340458, 38401067
Osteosarcoma	Associate	18726921
Ovarian Diseases	Associate	35295989
Ovarian Neoplasms	Associate	17971902, 19383827, 19755862, 28407786, 28650468, 32977853, 35587258, 35741755, 35911442
Overweight	Inhibit	18635892
Parkinson Disease	Associate	34680941
Personality Disorders	Associate	29910679
Polycythemia Vera	Associate	30967632
Polyps	Associate	27050744
Prostatic Hyperplasia	Associate	24080497
Prostatic Intraepithelial Neoplasia	Associate	24080497
Prostatic Neoplasms	Associate	10839298, 24080497, 36142828
Prostatic Neoplasms Castration Resistant	Associate	23319273
Prostatic stromal proliferation of uncertain malignant potential	Inhibit	26847061
Prostatitis	Stimulate	8909245
Psoriasis	Inhibit	26634547
Rectal Neoplasms	Associate	23027623
Renal Insufficiency Chronic	Associate	24184689, 36923221
Retinoblastoma	Associate	30536303
Sarcoidosis	Associate	20851927
Scleroderma Systemic	Stimulate	37246768
Sepsis	Associate	23825193
Skin Diseases	Inhibit	26634547
Skin Neoplasms	Associate	30925905
Sleep Apnea Obstructive	Stimulate	24267255
Small Cell Lung Carcinoma	Associate	15173070
Squamous Cell Carcinoma of Head and Neck	Associate	23892499, 24155659, 28861772
Status Asthmaticus	Associate	20673984
Stomach Neoplasms	Associate	29434446, 29956792, 35627105
Stroke	Associate	25135788
Systemic Inflammatory Response Syndrome	Associate	37635488
Triple Negative Breast Neoplasms	Associate	26103053, 28220843
Uterine Cervical Neoplasms	Associate	18217980, 24403257
Virus Diseases	Associate	25798824

DUSP1 (dual specificity phosphatase 1)