Gene Gene information from NCBI Gene database.
Entrez ID 1840
Gene name Deltex E3 ubiquitin ligase 1
Gene symbol DTX1
Synonyms (NCBI Gene)
RNF140hDx-1
Chromosome 12
Chromosome location 12q24.13
Summary Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity. [pr
miRNA miRNA information provided by mirtarbase database.
91
miRTarBase ID miRNA Experiments Reference
MIRT017334 hsa-miR-335-5p Microarray 18185580
MIRT023569 hsa-miR-1-3p Microarray 18668037
MIRT711752 hsa-miR-6849-3p HITS-CLIP 19536157
MIRT711751 hsa-miR-6515-3p HITS-CLIP 19536157
MIRT711750 hsa-miR-1236-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity TAS 9590294
GO:0005112 Function Notch binding IDA 11564735
GO:0005515 Function Protein binding IPI 7671825, 17028573, 21124883, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602582 3060 ENSG00000135144
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86Y01
Protein name E3 ubiquitin-protein ligase DTX1 (EC 2.3.2.27) (Protein deltex-1) (Deltex1) (hDTX1) (RING-type E3 ubiquitin transferase DTX1)
Protein function Functions as a ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity (By similarity). Regulator of Notch signaling, a s
PDB 6Y5N , 6Y5P , 8R5N , 8R6A , 8R6B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02825 WWE 26 94 WWE domain Family
PF02825 WWE 107 171 WWE domain Family
PF00097 zf-C3HC4 411 471 Zinc finger, C3HC4 type (RING finger) Domain
PF18102 DTC 479 613 Deltex C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Strongly expressed in blood vessel. Also expressed in embryonic nervous system, pancreas, lung, adrenal gland, digestive tube and muscles. Expressed in MZB cells and developing B- and T-cells. {ECO:0000269|PubMed:1275
Sequence
MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRR
NFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRR
RLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGG
PPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ
RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHP
PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT
ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTC
KAIYGEKTG
TQPPGKMEFHLIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPN
NEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASY
LDNVLAELTAQGV
SEAAAKA
Sequence length 620
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Notch signaling pathway   Activated NOTCH1 Transmits Signal to the Nucleus
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs2044645304 RCV004560245
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 27557513, 32700476
Colorectal Neoplasms Associate 36160034
COVID 19 Associate 34799557
Fatigue Associate 39661563
Glioblastoma Associate 23451269, 26662803
Hereditary Breast and Ovarian Cancer Syndrome Associate 35937947
Leukemia Lymphocytic Chronic B Cell Associate 28931525
Lymphoma B Cell Associate 33945543
Lymphoma B Cell Marginal Zone Associate 22891273
Lymphoma Follicular Associate 30802265