Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1839
Gene name	Heparin binding EGF like growth factor
Gene symbol	HBEGF
Synonyms (NCBI Gene)	DTRDTSDTSFHEGFL
Chromosome	5
Chromosome location	5q31.3

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005891	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT005891	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT006659	hsa-miR-132-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21853268
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Microarray	17612493
MIRT024470	hsa-miR-215-5p	Microarray	19074876
MIRT026939	hsa-miR-192-5p	Microarray	19074876
MIRT027820	hsa-miR-98-5p	Microarray	19088304
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assayqRT-PCRWestern blot	24136232
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT732695	hsa-miR-96-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	33973871
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041442	hsa-miR-194	CLIP-seq
MIRT1041443	hsa-miR-203	CLIP-seq
MIRT1041444	hsa-miR-2053	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT1041446	hsa-miR-2277-3p	CLIP-seq
MIRT1041447	hsa-miR-3180-5p	CLIP-seq
MIRT1041448	hsa-miR-3619-3p	CLIP-seq
MIRT1041449	hsa-miR-3622a-5p	CLIP-seq
MIRT1041450	hsa-miR-3973	CLIP-seq
MIRT1041451	hsa-miR-4423-3p	CLIP-seq
MIRT1041452	hsa-miR-4445	CLIP-seq
MIRT1041453	hsa-miR-4517	CLIP-seq
MIRT1041454	hsa-miR-4640-5p	CLIP-seq
MIRT1041455	hsa-miR-4726-5p	CLIP-seq
MIRT1041456	hsa-miR-4760-5p	CLIP-seq
MIRT1041457	hsa-miR-4795-3p	CLIP-seq
MIRT1041458	hsa-miR-518a-5p	CLIP-seq
MIRT1041459	hsa-miR-520a-5p	CLIP-seq
MIRT1041460	hsa-miR-525-5p	CLIP-seq
MIRT1041461	hsa-miR-527	CLIP-seq
MIRT1041462	hsa-miR-548a-5p	CLIP-seq
MIRT1041463	hsa-miR-548ab	CLIP-seq
MIRT1041464	hsa-miR-548ak	CLIP-seq
MIRT1041465	hsa-miR-548b-5p	CLIP-seq
MIRT1041466	hsa-miR-548c-5p	CLIP-seq
MIRT1041467	hsa-miR-548d-5p	CLIP-seq
MIRT1041468	hsa-miR-548h	CLIP-seq
MIRT1041469	hsa-miR-548i	CLIP-seq
MIRT1041470	hsa-miR-548j	CLIP-seq
MIRT1041471	hsa-miR-548l	CLIP-seq
MIRT1041472	hsa-miR-548w	CLIP-seq
MIRT1041473	hsa-miR-548y	CLIP-seq
MIRT1041474	hsa-miR-559	CLIP-seq
MIRT1041475	hsa-miR-591	CLIP-seq
MIRT1041476	hsa-miR-645	CLIP-seq
MIRT1041477	hsa-miR-656	CLIP-seq
MIRT1041478	hsa-miR-802	CLIP-seq
MIRT2008693	hsa-miR-3065-3p	CLIP-seq
MIRT2008694	hsa-miR-3126-5p	CLIP-seq
MIRT2008695	hsa-miR-3160-5p	CLIP-seq
MIRT2008696	hsa-miR-4419a	CLIP-seq
MIRT2008697	hsa-miR-4510	CLIP-seq
MIRT2008698	hsa-miR-4710	CLIP-seq
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT2388914	hsa-miR-4773	CLIP-seq
MIRT2450983	hsa-miR-3132	CLIP-seq
MIRT2450984	hsa-miR-4650-3p	CLIP-seq
MIRT2450985	hsa-miR-587	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
HIF1A	Activation	22641673
MYOD1	Activation	22641673
NFKB1	Activation	22641673
RELA	Activation	22641673
SNAI1	Activation	22641673
SP1	Activation	22641673
SP3	Activation	22641673
WT1	Activation	22641673
WT1	Unknown	17430890

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	TAS	10749879
GO:0005515	Function	Protein binding	IPI	9135143, 28988771, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8702723
GO:0005615	Component	Extracellular space	IDA	12743035
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005615	Component	Extracellular space	TAS	15389565
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	15389565
GO:0007165	Process	Signal transduction	TAS	1840698
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8702723
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	17655843
GO:0007517	Process	Muscle organ development	TAS	8347598
GO:0008016	Process	Regulation of heart contraction	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	12070119
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	8300582
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009986	Component	Cell surface	IDA	12743035
GO:0009986	Component	Cell surface	NAS	15289334
GO:0010561	Process	Negative regulation of glycoprotein biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	8702723
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	17655843
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0038134	Process	ERBB2-EGFR signaling pathway	IEA
GO:0038135	Process	ERBB2-ERBB4 signaling pathway	IEA
GO:0048018	Function	Receptor ligand activity	IDA	8702723
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17655843
GO:0060326	Process	Cell chemotaxis	IMP	24008408
GO:0090303	Process	Positive regulation of wound healing	IMP	17655843

MIM	HGNC	e!Ensembl
126150	3059	ENSG00000113070

Q99075

Protein name

Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor (HB-EGF) (HBEGF) (Diphtheria toxin receptor) (DT-R)]

Protein function

Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. I

PDB

1XDT , 2M8S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	108 → 142	EGF-like domain	Domain

Sequence

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH

Sequence length

208

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance ErbB signaling pathway GnRH signaling pathway Estrogen signaling pathway Parathyroid hormone synthesis, secretion and action Epithelial cell signaling in Helicobacter pylori infection Coronavirus disease - COVID-19 Proteoglycans in cancer Bladder cancer		Signaling by ERBB2 Signaling by ERBB4 SHC1 events in ERBB2 signaling PI3K events in ERBB4 signaling SHC1 events in ERBB4 signaling PIP3 activates AKT signaling Signaling by EGFR GRB2 events in EGFR signaling GAB1 signalosome SHC1 events in EGFR signaling EGFR downregulation GRB2 events in ERBB2 signaling PI3K events in ERBB2 signaling EGFR interacts with phospholipase C-gamma EGFR Transactivation by Gastrin Constitutive Signaling by Aberrant PI3K in Cancer Uptake and function of diphtheria toxin Inhibition of Signaling by Overexpressed EGFR RAF/MAP kinase cascade ERBB2 Regulates Cell Motility PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling ERBB2 Activates PTK6 Signaling Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis PTK6 promotes HIF1A stabilization Downregulation of ERBB2 signaling Extra-nuclear estrogen signaling Estrogen-dependent nuclear events downstream of ESR-membrane signaling Signaling by ERBB2 KD Mutants Signaling by ERBB2 TMD/JMD mutants

HBEGF (heparin binding EGF like growth factor)