HBEGF (heparin binding EGF like growth factor)

Gene

• Entrez ID: 1839
• Gene name: Heparin binding EGF like growth factor
• Gene symbol: HBEGF
• Synonyms (NCBI Gene): DTR, DTS, DTSF, HEGFL
• Chromosome: 5
• Chromosome location: 5q31.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005891	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT005891	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853268
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Luciferase reporter assay	22310291
MIRT006659	hsa-miR-132-3p	Microarray	17612493
MIRT024470	hsa-miR-215-5p	Microarray	19074876
MIRT026939	hsa-miR-192-5p	Microarray	19074876
MIRT027820	hsa-miR-98-5p	Microarray	19088304
MIRT438721	mmu-miR-1192	Luciferase reporter assay, qRT-PCR, Western blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assay, qRT-PCR, Western blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assay, qRT-PCR, Western blot	24136232
MIRT438721	mmu-miR-1192	Luciferase reporter assay, qRT-PCR, Western blot	24136232
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT732695	hsa-miR-96-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	33973871
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT657502	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT657509	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT657508	hsa-miR-3690	HITS-CLIP	23824327
MIRT657507	hsa-miR-4254	HITS-CLIP	23824327
MIRT657506	hsa-miR-6081	HITS-CLIP	23824327
MIRT657505	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT657504	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT657503	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT657502	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT657501	hsa-miR-4719	HITS-CLIP	23824327
MIRT657500	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT657499	hsa-miR-1248	HITS-CLIP	23824327
MIRT657498	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT657497	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT657496	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT657495	hsa-miR-513b-5p	HITS-CLIP	23824327
MIRT657494	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT657493	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT657492	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT657491	hsa-miR-5691	HITS-CLIP	23824327
MIRT657490	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT657489	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT657488	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041442	hsa-miR-194	CLIP-seq
MIRT1041443	hsa-miR-203	CLIP-seq
MIRT1041444	hsa-miR-2053	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT1041446	hsa-miR-2277-3p	CLIP-seq
MIRT1041447	hsa-miR-3180-5p	CLIP-seq
MIRT1041448	hsa-miR-3619-3p	CLIP-seq
MIRT1041449	hsa-miR-3622a-5p	CLIP-seq
MIRT1041450	hsa-miR-3973	CLIP-seq
MIRT1041451	hsa-miR-4423-3p	CLIP-seq
MIRT1041452	hsa-miR-4445	CLIP-seq
MIRT1041453	hsa-miR-4517	CLIP-seq
MIRT1041454	hsa-miR-4640-5p	CLIP-seq
MIRT1041455	hsa-miR-4726-5p	CLIP-seq
MIRT1041456	hsa-miR-4760-5p	CLIP-seq
MIRT1041457	hsa-miR-4795-3p	CLIP-seq
MIRT1041458	hsa-miR-518a-5p	CLIP-seq
MIRT1041459	hsa-miR-520a-5p	CLIP-seq
MIRT1041460	hsa-miR-525-5p	CLIP-seq
MIRT1041461	hsa-miR-527	CLIP-seq
MIRT1041462	hsa-miR-548a-5p	CLIP-seq
MIRT1041463	hsa-miR-548ab	CLIP-seq
MIRT1041464	hsa-miR-548ak	CLIP-seq
MIRT1041465	hsa-miR-548b-5p	CLIP-seq
MIRT1041466	hsa-miR-548c-5p	CLIP-seq
MIRT1041467	hsa-miR-548d-5p	CLIP-seq
MIRT1041468	hsa-miR-548h	CLIP-seq
MIRT1041469	hsa-miR-548i	CLIP-seq
MIRT1041470	hsa-miR-548j	CLIP-seq
MIRT1041471	hsa-miR-548l	CLIP-seq
MIRT1041472	hsa-miR-548w	CLIP-seq
MIRT1041473	hsa-miR-548y	CLIP-seq
MIRT1041474	hsa-miR-559	CLIP-seq
MIRT1041475	hsa-miR-591	CLIP-seq
MIRT1041476	hsa-miR-645	CLIP-seq
MIRT1041477	hsa-miR-656	CLIP-seq
MIRT1041478	hsa-miR-802	CLIP-seq
MIRT2008693	hsa-miR-3065-3p	CLIP-seq
MIRT2008694	hsa-miR-3126-5p	CLIP-seq
MIRT2008695	hsa-miR-3160-5p	CLIP-seq
MIRT2008696	hsa-miR-4419a	CLIP-seq
MIRT2008697	hsa-miR-4510	CLIP-seq
MIRT2008698	hsa-miR-4710	CLIP-seq
MIRT1041441	hsa-miR-132	CLIP-seq
MIRT1041445	hsa-miR-212	CLIP-seq
MIRT2388914	hsa-miR-4773	CLIP-seq
MIRT2450983	hsa-miR-3132	CLIP-seq
MIRT2450984	hsa-miR-4650-3p	CLIP-seq
MIRT2450985	hsa-miR-587	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIF1A	Activation	22641673
MYOD1	Activation	22641673
NFKB1	Activation	22641673
RELA	Activation	22641673
SNAI1	Activation	22641673
SP1	Activation	22641673
SP3	Activation	22641673
WT1	Activation	22641673
WT1	Unknown	17430890

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0005154	Function	Epidermal growth factor receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9135143, 28988771, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12743035
GO:0005615	Component	Extracellular space	ISS
GO:0005615	Component	Extracellular space	TAS	15389565
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0005887	Component	Integral component of plasma membrane	TAS	15389565
GO:0007165	Process	Signal transduction	TAS
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	17655843
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS
GO:0007517	Process	Muscle organ development	TAS	8347598
GO:0008016	Process	Regulation of heart contraction	IEA
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	12070119
GO:0008201	Function	Heparin binding	IBA	21873635
GO:0008201	Function	Heparin binding	IMP	8300582
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0009986	Component	Cell surface	IDA	12743035
GO:0009986	Component	Cell surface	NAS	15289334
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	17655843
GO:0030665	Component	Clathrin-coated vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	TAS
GO:0045741	Process	Positive regulation of epidermal growth factor-activated receptor activity	IBA	21873635
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051545	Process	Negative regulation of elastin biosynthetic process	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	17655843
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060326	Process	Cell chemotaxis	IMP	24008408
GO:0061024	Process	Membrane organization	TAS
GO:0090303	Process	Positive regulation of wound healing	IMP	17655843
GO:2000145	Process	Regulation of cell motility	TAS

Other IDs

• MIM: 126150
• HGNC: 3059
• e!Ensembl: ENSG00000113070

Protein

• UniProt ID: Q99075
• Protein name: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor (HB-EGF) (HBEGF) (Diphtheria toxin receptor) (DT-R)]
• Protein function: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. I
• PDB: 1XDT, 2M8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00008	EGF	108 → 142	EGF-like domain	Domain

• Sequence:

  MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
  VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
  CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
  LLMFRYHRRGGYDVENEEKVKLGMTNSH

• Sequence length: 208

Pathways

KEGG:

Endocrine resistance
ErbB signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Parathyroid hormone synthesis, secretion and action
Epithelial cell signaling in Helicobacter pylori infection
Coronavirus disease - COVID-19
Proteoglycans in cancer
Bladder cancer

Reactome:

Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PI3K events in ERBB4 signaling
SHC1 events in ERBB4 signaling
PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
GRB2 events in ERBB2 signaling
PI3K events in ERBB2 signaling
EGFR interacts with phospholipase C-gamma
EGFR Transactivation by Gastrin
Constitutive Signaling by Aberrant PI3K in Cancer
Uptake and function of diphtheria toxin
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
PTK6 promotes HIF1A stabilization
Downregulation of ERBB2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675	28416822
Epilepsy	Epilepsy, Tonic-Clonic, Familial, Epilepsy, Tonic-Clonic, Symptomatic	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	16023256
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	15723263
Left ventricular hypertrophy	Left Ventricular Hypertrophy	rs397516037	9709397

Unknown
Disease term	Disease name	Evidence	References	Source
Endometriosis	Endometriosis		20864642	ClinVar
Atrial Fibrillation	Atrial Fibrillation			GWAS
Dementia	Dementia			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Abortion Spontaneous	Associate	23907942
Adenocarcinoma	Associate	26683690
Antiphospholipid Syndrome	Inhibit	20131286
Arthritis Psoriatic	Associate	32415989
Asthma	Associate	23517395
Atherosclerosis	Associate	1577791, 8302833
Breast Neoplasms	Associate	17962208
Calcinosis Cutis	Associate	10735511
Carcinoma	Associate	15274392, 23917679
Carcinoma Adenoid Cystic	Associate	32386517
Carcinoma Hepatocellular	Associate	34028973, 9244191
Carcinoma Non Small Cell Lung	Associate	33400994
Carcinoma Ovarian Epithelial	Stimulate	25201063
Carcinoma Ovarian Epithelial	Associate	34320033
Carcinoma Papillary	Associate	23917679
Cell Transformation Neoplastic	Associate	21978696
Colorectal Neoplasms	Associate	17222808, 19221016, 21978696, 29361822, 35633908, 36172359
Complement Factor H Deficiency	Associate	22319602
COVID 19	Associate	35718334, 36380355
Dermatitis Atopic	Stimulate	24658508
Fibrosis	Associate	29581578, 34742261
Gastroesophageal Reflux	Associate	20351696
Gastrointestinal Stromal Tumors	Associate	19298600
Glioblastoma	Associate	15509542, 29559295, 40073406
Gout	Associate	35116032
Haspeslagh Fryns Muelenaere syndrome	Associate	12547714
Head and Neck Neoplasms	Associate	32627036
Histiocytoma Malignant Fibrous	Associate	15274392
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	26800359
Hyperplasia	Associate	17637826, 19120344
Hypertension Pregnancy Induced	Associate	20131286
Hypoxia	Associate	23589494
Hypoxia	Stimulate	26800359
Hypoxia Brain	Associate	32386517
Kidney Failure Chronic	Associate	22319602
Latent Tuberculosis	Associate	27852671
Leukemia	Associate	10029601
Leukemia Biphenotypic Acute	Associate	37845689
Leukemia Myeloid Acute	Associate	10029601
Leukoplakia	Associate	24403051
Lung Neoplasms	Associate	26683690
Melanoma	Associate	26434590
Meningeal Carcinomatosis	Associate	26980026
Mitochondrial Diseases	Stimulate	35342363
Mixed Tumor Mullerian	Associate	26980026
Mucositis	Associate	9062361
Multiple Myeloma	Associate	11468178, 14576062, 17823079
Myocardial Infarction	Associate	35886020
Neoplasm Metastasis	Associate	23917679, 26980026, 32386517, 35633908
Neoplasms	Associate	15274392, 15755902, 17394193, 17962208, 19298600, 20946474, 21978696, 22209887, 23589494, 27888810, 28174207, 28498437, 32386517, 33400994, 39329717
Neoplasms Cystic Mucinous and Serous	Associate	26980026
Neuroblastoma	Associate	28174207
Non alcoholic Fatty Liver Disease	Associate	36380355
Odontogenic Cysts	Associate	31319505
Ovarian Neoplasms	Associate	20946474, 25060396, 25261977, 27888810, 34320033, 35342363
Pancreatic Neoplasms	Associate	20208558, 9802880
Polycystic Ovary Syndrome	Associate	35342363
Pre Eclampsia	Inhibit	16407398
Pre Eclampsia	Associate	20131286
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32893872
Pregnancy in Diabetics	Associate	16407398
Prostatic Neoplasms	Associate	27966447
Psoriasis	Associate	17637826
Pterygium	Associate	12547714
Pulmonary Disease Chronic Obstructive	Associate	22701684
Pulmonary Disease Chronic Obstructive	Stimulate	29581578, 34742261
Reproductive Tract Infections	Associate	23907942
Sarcoidosis	Associate	33276795
Squamous Cell Carcinoma of Head and Neck	Associate	20856931, 23146907, 32627036
Stomach Diseases	Associate	29379775
Stomach Neoplasms	Associate	19337254, 20946474, 27933395, 29379775, 35264144
Thyroid Neoplasms	Associate	23917679
Urinary Bladder Neoplasms	Associate	17394193, 17909029
Uterine Cervical Neoplasms	Associate	28498437
Vitreoretinopathy Proliferative	Associate	15988409