Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1824
Gene name Gene Name - the full gene name approved by the HGNC.
Desmocollin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DSC2
Synonyms (NCBI Gene) Gene synonyms aliases
ARVD11, CDHF2, DG2, DGII/III, DSC3
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the desmocollin protein subfamily. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Desmosomes are cell-cell junctions that help resist shearing f
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137941742 T>C Likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant, 5 prime UTR variant
rs138643506 C>T Uncertain-significance, benign-likely-benign, likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant, 5 prime UTR variant
rs138749562 A>C Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, 5 prime UTR variant
rs142410803 G>A,C Uncertain-significance, benign, benign-likely-benign, likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs143342988 T>C Likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, 3 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019103 hsa-miR-335-5p Microarray 18185580
MIRT025897 hsa-miR-7-5p Microarray 17612493
MIRT030595 hsa-miR-24-3p Microarray 19748357
MIRT053236 hsa-miR-25-3p Luciferase reporter assay, Western blot 23836524
MIRT053236 hsa-miR-25-3p Luciferase reporter assay, Western blot 23836524
Transcription factors
Transcription factor Regulation Reference
CDX1 Unknown 18819935
CDX2 Unknown 18819935
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001533 Component Cornified envelope IEA
GO:0001533 Component Cornified envelope TAS
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 21062920, 21220045
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
125645 3036 ENSG00000134755
Protein
UniProt ID Q02487
Protein name Desmocollin-2 (Cadherin family member 2) (Desmocollin-3) (Desmosomal glycoprotein II) (Desmosomal glycoprotein III)
Protein function A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (PubMed:33596089). Promotes timely incorporation of DSG2 into desmosome intercellular junctions and promotes interaction of desmosome ce
PDB 5ERP , 5J5J , 7A7D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08758 Cadherin_pro 30 113 Cadherin prodomain like Domain
PF00028 Cadherin 140 234 Cadherin domain Domain
PF00028 Cadherin 248 346 Cadherin domain Domain
PF00028 Cadherin 360 463 Cadherin domain Domain
PF00028 Cadherin 476 568 Cadherin domain Domain
PF01049 Cadherin_C 798 901 Cadherin cytoplasmic region Family
Tissue specificity TISSUE SPECIFICITY: Expressed at intercalated disks in the heart, where it is colocalized with CDH2 (at protein level) (PubMed:23863954, PubMed:33784018). Expressed in intestinal mucosal cells (at protein level) (PubMed:31967937). {ECO:0000269|PubMed:2386
Sequence
MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTA
ANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFL
EHQTKVL
KKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQ
EPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIE
DENDNY
PIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPT
TGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINID
DVNDHLPTFTRTSY
VTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVV
KPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVE
DQDEGPECNPPIQTVRM
KENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETI
KNGIYNITVLASDQGGRTCTGTLGIILQ
DVNDNSPFIPKKTVIICKPTMSSAEIVAVDPD
EPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSS
VTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASG
TSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGG
QETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYL
CNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMK
R
Sequence length 901
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytoskeleton in muscle cells
Arrhythmogenic right ventricular cardiomyopathy
  Keratinization
Formation of the cornified envelope
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular dysplasia 11 rs769022411, rs145476705, rs1598572298, rs794728072, rs1598592533, rs1987170019, rs878853170, rs1060502989, rs1064795963, rs1555639134, rs397514041, rs1555640399, rs746173561, rs1555637555 N/A
arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy rs397517393, rs145476705 N/A
Dilated Cardiomyopathy Dilated cardiomyopathy 1A rs794728072 N/A
Arrhythmogenic right ventricular cardiomyopathy with palmoplantar keratoderma and woolly hair arrhythmogenic right ventricular dysplasia, familial, 11, with mild palmoplantar keratoderma and woolly hair rs397514043 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Adenoma colorectal adenoma N/A N/A GenCC
Bronchopulmonary Dysplasia Bronchopulmonary dysplasia N/A N/A GWAS
cardiomyopathy Cardiomyopathy N/A N/A ClinVar
Cardiomyopathy Primary dilated cardiomyopathy, Primary familial dilated cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arrhythmias Cardiac Associate 31484862, 34819141
Arrhythmogenic Right Ventricular Dysplasia Associate 17033975, 20124997, 20152563, 20197793, 21636032, 21822014, 22214898, 24086444, 25390934, 25445213, 25497880, 25837155, 29178656, 31024045, 31484862
View all (5 more)
Arrhythmogenic Right Ventricular Dysplasia Inhibit 35628349
Atrial Fibrillation Associate 34819141
Breast Neoplasms Associate 25809865
Bundle Branch Block Associate 31484862
Carcinoma Hepatocellular Associate 36367775
Cardiomyopathy Dilated Associate 31024045
Cardiomyopathy Dilated with Left Ventricular Noncompaction Associate 34819141
Cardiomyopathy Hypertrophic Associate 34819141