Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	1819
Gene name	Developmentally regulated GTP binding protein 2
Gene symbol	DRG2
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a GTP-binding protein known to function in the regulation of cell growth and differentiation. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein.

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022334	hsa-miR-124-3p	Microarray	18668037
MIRT032283	hsa-let-7b-5p	Proteomics	18668040
MIRT041434	hsa-miR-193b-3p	CLASH	23622248
MIRT039603	hsa-miR-616-5p	CLASH	23622248
MIRT945389	hsa-miR-146b-3p	CLIP-seq
MIRT945390	hsa-miR-3173-5p	CLIP-seq
MIRT945391	hsa-miR-3192	CLIP-seq
MIRT945392	hsa-miR-3689a-3p	CLIP-seq
MIRT945393	hsa-miR-3689c	CLIP-seq
MIRT945394	hsa-miR-4292	CLIP-seq
MIRT945395	hsa-miR-4716-3p	CLIP-seq
MIRT945396	hsa-miR-4728-5p	CLIP-seq
MIRT945397	hsa-miR-625	CLIP-seq
MIRT945398	hsa-miR-874	CLIP-seq
MIRT1979866	hsa-miR-1343	CLIP-seq
MIRT1979867	hsa-miR-3121-3p	CLIP-seq
MIRT1979868	hsa-miR-3126-5p	CLIP-seq
MIRT1979869	hsa-miR-3127-3p	CLIP-seq
MIRT1979870	hsa-miR-3182	CLIP-seq
MIRT1979871	hsa-miR-3607-3p	CLIP-seq
MIRT1979872	hsa-miR-3667-3p	CLIP-seq
MIRT1979873	hsa-miR-3686	CLIP-seq
MIRT1979874	hsa-miR-4419a	CLIP-seq
MIRT1979875	hsa-miR-4510	CLIP-seq
MIRT1979876	hsa-miR-4685-5p	CLIP-seq
MIRT1979877	hsa-miR-711	CLIP-seq
MIRT2215065	hsa-miR-1283	CLIP-seq
MIRT2215066	hsa-miR-1827	CLIP-seq
MIRT2215067	hsa-miR-24	CLIP-seq
MIRT2215068	hsa-miR-3065-3p	CLIP-seq
MIRT2215069	hsa-miR-3155	CLIP-seq
MIRT2215070	hsa-miR-3155b	CLIP-seq
MIRT2215071	hsa-miR-3665	CLIP-seq
MIRT1979876	hsa-miR-4685-5p	CLIP-seq
MIRT2215072	hsa-miR-4691-3p	CLIP-seq
MIRT2215073	hsa-miR-4736	CLIP-seq
MIRT2215074	hsa-miR-484	CLIP-seq
MIRT2215075	hsa-miR-940	CLIP-seq
MIRT1979876	hsa-miR-4685-5p	CLIP-seq
MIRT2215072	hsa-miR-4691-3p	CLIP-seq
MIRT1979877	hsa-miR-711	CLIP-seq
MIRT1979876	hsa-miR-4685-5p	CLIP-seq
MIRT2215072	hsa-miR-4691-3p	CLIP-seq
MIRT2519514	hsa-miR-1291	CLIP-seq
MIRT2519515	hsa-miR-1295	CLIP-seq
MIRT2519516	hsa-miR-148a	CLIP-seq
MIRT2519517	hsa-miR-148b	CLIP-seq
MIRT2519518	hsa-miR-152	CLIP-seq
MIRT2519519	hsa-miR-1908	CLIP-seq
MIRT2519520	hsa-miR-1909	CLIP-seq
MIRT2519521	hsa-miR-299-3p	CLIP-seq
MIRT2519522	hsa-miR-3064-5p	CLIP-seq
MIRT2519523	hsa-miR-3652	CLIP-seq
MIRT2519524	hsa-miR-4253	CLIP-seq
MIRT2519525	hsa-miR-4265	CLIP-seq
MIRT2519526	hsa-miR-4296	CLIP-seq
MIRT2519527	hsa-miR-4322	CLIP-seq
MIRT2519528	hsa-miR-4417	CLIP-seq
MIRT2519529	hsa-miR-4430	CLIP-seq
MIRT2519530	hsa-miR-4469	CLIP-seq
MIRT2519531	hsa-miR-4492	CLIP-seq
MIRT2519532	hsa-miR-4498	CLIP-seq
MIRT2519533	hsa-miR-4505	CLIP-seq
MIRT2519534	hsa-miR-4686	CLIP-seq
MIRT2519535	hsa-miR-4747-3p	CLIP-seq
MIRT2519536	hsa-miR-663	CLIP-seq
MIRT1979877	hsa-miR-711	CLIP-seq
MIRT2519537	hsa-miR-762	CLIP-seq
MIRT2519538	hsa-miR-891b	CLIP-seq
MIRT2519514	hsa-miR-1291	CLIP-seq
MIRT2519515	hsa-miR-1295	CLIP-seq
MIRT2519516	hsa-miR-148a	CLIP-seq
MIRT2519517	hsa-miR-148b	CLIP-seq
MIRT2519518	hsa-miR-152	CLIP-seq
MIRT2519519	hsa-miR-1908	CLIP-seq
MIRT2519520	hsa-miR-1909	CLIP-seq
MIRT2519521	hsa-miR-299-3p	CLIP-seq
MIRT2519522	hsa-miR-3064-5p	CLIP-seq
MIRT945391	hsa-miR-3192	CLIP-seq
MIRT2519523	hsa-miR-3652	CLIP-seq
MIRT945392	hsa-miR-3689a-3p	CLIP-seq
MIRT945393	hsa-miR-3689c	CLIP-seq
MIRT2519524	hsa-miR-4253	CLIP-seq
MIRT2519525	hsa-miR-4265	CLIP-seq
MIRT2519526	hsa-miR-4296	CLIP-seq
MIRT2519527	hsa-miR-4322	CLIP-seq
MIRT2519528	hsa-miR-4417	CLIP-seq
MIRT2519529	hsa-miR-4430	CLIP-seq
MIRT2519530	hsa-miR-4469	CLIP-seq
MIRT2519531	hsa-miR-4492	CLIP-seq
MIRT2519532	hsa-miR-4498	CLIP-seq
MIRT2519533	hsa-miR-4505	CLIP-seq
MIRT2519534	hsa-miR-4686	CLIP-seq
MIRT945396	hsa-miR-4728-5p	CLIP-seq
MIRT2519535	hsa-miR-4747-3p	CLIP-seq
MIRT2519536	hsa-miR-663	CLIP-seq
MIRT1979877	hsa-miR-711	CLIP-seq
MIRT2519537	hsa-miR-762	CLIP-seq
MIRT2519538	hsa-miR-891b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Unknown	21296692

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002181	Process	Cytoplasmic translation	IBA
GO:0003723	Function	RNA binding	IDA	29915238
GO:0003924	Function	GTPase activity	IDA	29915238
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 29915238, 32296183, 32814053, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS	7929244
GO:0005634	Component	Nucleus	IDA	29915238
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29915238
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	7929244
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602986	3030	ENSG00000108591

P55039

Protein name

Developmentally-regulated GTP-binding protein 2 (DRG-2) (Translation factor GTPase DRG2) (TRAFAC GTPase DRG2) (EC 3.6.5.-)

Protein function

Catalyzes the conversion of GTP to GDP through hydrolysis of the gamma-phosphate bond in GTP. When hydroxylated at C-3 of 'Lys-21' by JMJD7, may bind to RNA and play a role in translation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01926	MMR_HSR1	64 → 181	50S ribosome-binding GTPase	Family
PF16897	MMR_HSR1_Xtn	184 → 289	C-terminal region of MMR_HSR1 domain	Family
PF02824	TGS	290 → 363	TGS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in skeletal muscle, heart and kidney. Low levels in colon, thymus, spleen, small intestine, lung and Leukocytes.

Sequence

MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKS
GDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVIIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFK
PKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMP
CLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQR
PDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQ
IVKK

Sequence length

364

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	30281872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30281872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Potocki Lupski syndrome	Associate	28413209	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	34190439	★★★★★ ★☆☆☆☆ Found in Text Mining only

DRG2 (developmentally regulated GTP binding protein 2)