Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1814
Gene name Gene Name - the full gene name approved by the HGNC.	Dopamine receptor D3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DRD3
Synonyms (NCBI Gene) Gene synonyms aliases	D3DR, ETM1, FET1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated wi

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6280	C>T	Risk-factor, benign, likely-benign	Coding sequence variant, missense variant

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029658	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IBA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IDA	8301582
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IEA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	ISS
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	18424554
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	10692483, 16386234, 18424554, 26460884
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	8301582
GO:0005886	Component	Plasma membrane	IDA	8413587, 16386234, 18424554, 20531939
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	7911712
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	7911712
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	18424554
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IBA
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	7907363, 8666994, 18424554
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA
GO:0007611	Process	Learning or memory	NAS	14681904
GO:0007612	Process	Learning	NAS	15998189
GO:0007626	Process	Locomotory behavior	ISS
GO:0008542	Process	Visual learning	ISS
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0014059	Process	Regulation of dopamine secretion	IBA
GO:0014059	Process	Regulation of dopamine secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034776	Process	Response to histamine	IDA	16839358
GO:0035176	Process	Social behavior	NAS	12860355
GO:0042220	Process	Response to cocaine	IEP	10415668
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0043266	Process	Regulation of potassium ion transport	IBA
GO:0043278	Process	Response to morphine	ISS
GO:0045202	Component	Synapse	IEA
GO:0045471	Process	Response to ethanol	ISS
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	ISS
GO:0046717	Process	Acid secretion	ISS
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048148	Process	Behavioral response to cocaine	IEP	8815892
GO:0048148	Process	Behavioral response to cocaine	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0050482	Process	Arachidonate secretion	IDA	8301582
GO:0050709	Process	Negative regulation of protein secretion	IDA	16839358
GO:0050883	Process	Musculoskeletal movement, spinal reflex action	ISS
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IBA
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051952	Process	Regulation of amine transport	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IBA
GO:0060134	Process	Prepulse inhibition	IMP	18325483
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IBA
GO:0060161	Process	Positive regulation of dopamine receptor signaling pathway	ISS
GO:1903530	Process	Regulation of secretion by cell	IEA

MIM	HGNC	e!Ensembl
126451	3024	ENSG00000151577

Protein

UniProt ID

P35462

Protein name

D(3) dopamine receptor (Dopamine D3 receptor)

Protein function

Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.

PDB

3PBL , 7CMU , 7CMV , 8IRT , 9F33 , 9F34

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	46 → 383	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Brain.

Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Sequence length

400

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling Dopaminergic synapse		Dopamine receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma (childhood onset)	N/A	N/A	GWAS
hereditary essential tremor	Hereditary essential tremor	N/A	N/A	ClinVar
Schizophrenia	Schizophrenia, susceptibility to	N/A	N/A	ClinVar
TREMOR	tremor, hereditary essential, 1	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Pain	Associate	25102390
Adenocarcinoma of Lung	Associate	30419062
Akathisia Drug Induced	Associate	23226551
Alzheimer Disease	Associate	11723200
Anemia Sickle Cell	Associate	25102390, 35285297
Antisocial Personality Disorder	Associate	23891037
Autism Spectrum Disorder	Associate	21691864, 23032108
Autistic Disorder	Associate	25158632, 28470827, 29249220
Bipolar Disorder	Associate	27310943, 28751646
Carcinoma Hepatocellular	Associate	36456906
Chronic Pain	Associate	19464960
Cognition Disorders	Associate	21491142
Delusional Parasitosis	Associate	11723200
Depressive Disorder Major	Associate	23365649
Developmental Disabilities	Associate	22180640
Disruptive Impulse Control and Conduct Disorders	Associate	25896831, 32710539
Dyskinesia Drug Induced	Associate	16959057, 26718579, 29191473
Essential Tremor	Associate	15699368, 16809426, 18316228, 19524641, 23114103
Fibromyalgia	Associate	19464960
Hallucinations	Associate	32710539
Hashimoto Disease	Associate	34493981
HIV Infections	Associate	21491142
Hypercholesterolemia	Associate	40532247
Hyperprolactinemia	Associate	31520576
Hypertension	Associate	24308971
Hypoxia	Stimulate	19653907
Lung Neoplasms	Associate	30419062
Major Affective Disorder 2	Associate	9790747
Mental Disorders	Associate	21691864, 9790747
Metabolic Syndrome	Associate	27310943, 29791666
Movement Disorders	Associate	26787837
Neoplasms	Inhibit	36456906
Pain	Associate	19464960, 25102390, 35285297
Parkinson Disease	Associate	21663922, 25896831, 26627941
Parkinson Disease Secondary	Associate	26718579, 26787837
Postoperative Nausea and Vomiting	Associate	27729204
Psychotic Disorders	Associate	11723200
Schizophrenia	Stimulate	15920292
Schizophrenia	Associate	20100784, 23932573, 25158632, 25264289, 29791666, 9790747
Schizophrenia Treatment Resistant	Associate	36980961
Stress Disorders Post Traumatic	Associate	25158632
Substance Related Disorders	Associate	25158632
Tremor hereditary essential 1	Associate	12882651

DRD3 (dopamine receptor D3)