Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1814
Gene name Gene Name - the full gene name approved by the HGNC.	Dopamine receptor D3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DRD3
Synonyms (NCBI Gene) Gene synonyms aliases	D3DR, ETM1, FET1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ETM1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated wi

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6280	C>T	Risk-factor, benign, likely-benign	Coding sequence variant, missense variant

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029658	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IBA	21873635
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IDA	8301582
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	ISS
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	18424554
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10692483, 16386234, 18424554, 26460884
GO:0005886	Component	Plasma membrane	IDA	16386234, 18424554, 20531939
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IC	8301582
GO:0005887	Component	Integral component of plasma membrane	IDA	8413587
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	7911712
GO:0006914	Process	Autophagy	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	7911712
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	18424554
GO:0007194	Process	Negative regulation of adenylate cyclase activity	IBA	21873635
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IBA	21873635
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	7907363, 8666994, 18424554
GO:0007611	Process	Learning or memory	NAS	14681904
GO:0007612	Process	Learning	NAS	15998189
GO:0007626	Process	Locomotory behavior	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008542	Process	Visual learning	ISS
GO:0014059	Process	Regulation of dopamine secretion	IBA	21873635
GO:0014059	Process	Regulation of dopamine secretion	ISS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030139	Component	Endocytic vesicle	IEA
GO:0031748	Function	D1 dopamine receptor binding	IEA
GO:0032416	Process	Negative regulation of sodium:proton antiporter activity	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034776	Process	Response to histamine	IDA	16839358
GO:0035176	Process	Social behavior	NAS	12860355
GO:0035483	Process	Gastric emptying	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0042220	Process	Response to cocaine	IEP	10415668
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0042493	Process	Response to drug	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043266	Process	Regulation of potassium ion transport	IBA	21873635
GO:0043278	Process	Response to morphine	ISS
GO:0045177	Component	Apical part of cell	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045471	Process	Response to ethanol	ISS
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046717	Process	Acid secretion	ISS
GO:0048148	Process	Behavioral response to cocaine	IEP	8815892
GO:0048148	Process	Behavioral response to cocaine	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0050482	Process	Arachidonic acid secretion	IDA	8301582
GO:0050709	Process	Negative regulation of protein secretion	IDA	16839358
GO:0050883	Process	Musculoskeletal movement, spinal reflex action	ISS
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0051482	Process	Positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	21873635
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051898	Process	Negative regulation of protein kinase B signaling	ISS
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0060134	Process	Prepulse inhibition	IMP	18325483
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IBA	21873635
GO:0060161	Process	Positive regulation of dopamine receptor signaling pathway	ISS
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0090325	Process	Regulation of locomotion involved in locomotory behavior	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IBA	21873635

MIM	HGNC	e!Ensembl
126451	3024	ENSG00000151577

Protein

UniProt ID

P35462

Protein name

D(3) dopamine receptor (Dopamine D3 receptor)

Protein function

Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.

PDB

3PBL , 7CMU , 7CMV , 8IRT , 9F33 , 9F34

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	46 → 383	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Brain.

Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Sequence length

400

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling Dopaminergic synapse		Dopamine receptors G alpha (i) signalling events

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	19058789
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	10523822
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)	18566292
Tourette syndrome	Gilles de la Tourette syndrome	rs193302861, rs191284403, rs267606861	10523822
Tremor	TREMOR, HEREDITARY ESSENTIAL, 1	rs387907274, rs763485258, rs551348450

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Hereditary essential tremor	NON RARE IN EUROPE: Hereditary essential tremor		ClinVar
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Recurrent depression, Major Depressive Disorder	17851196, 21630437, 19235789, 23357086, 20685009, 21680027, 22093107, 16583407, 24927283, 8509522	ClinVar
Asthma	Asthma		GWAS

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Pain	Associate	25102390
Adenocarcinoma of Lung	Associate	30419062
Akathisia Drug Induced	Associate	23226551
Alzheimer Disease	Associate	11723200
Anemia Sickle Cell	Associate	25102390, 35285297
Antisocial Personality Disorder	Associate	23891037
Autism Spectrum Disorder	Associate	21691864, 23032108
Autistic Disorder	Associate	25158632, 28470827, 29249220
Bipolar Disorder	Associate	27310943, 28751646
Carcinoma Hepatocellular	Associate	36456906
Chronic Pain	Associate	19464960
Cognition Disorders	Associate	21491142
Delusional Parasitosis	Associate	11723200
Depressive Disorder Major	Associate	23365649
Developmental Disabilities	Associate	22180640
Disruptive Impulse Control and Conduct Disorders	Associate	25896831, 32710539
Dyskinesia Drug Induced	Associate	16959057, 26718579, 29191473
Essential Tremor	Associate	15699368, 16809426, 18316228, 19524641, 23114103
Fibromyalgia	Associate	19464960
Hallucinations	Associate	32710539
Hashimoto Disease	Associate	34493981
HIV Infections	Associate	21491142
Hypercholesterolemia	Associate	40532247
Hyperprolactinemia	Associate	31520576
Hypertension	Associate	24308971
Hypoxia	Stimulate	19653907
Lung Neoplasms	Associate	30419062
Major Affective Disorder 2	Associate	9790747
Mental Disorders	Associate	21691864, 9790747
Metabolic Syndrome	Associate	27310943, 29791666
Movement Disorders	Associate	26787837
Neoplasms	Inhibit	36456906
Pain	Associate	19464960, 25102390, 35285297
Parkinson Disease	Associate	21663922, 25896831, 26627941
Parkinson Disease Secondary	Associate	26718579, 26787837
Postoperative Nausea and Vomiting	Associate	27729204
Psychotic Disorders	Associate	11723200
Schizophrenia	Stimulate	15920292
Schizophrenia	Associate	20100784, 23932573, 25158632, 25264289, 29791666, 9790747
Schizophrenia Treatment Resistant	Associate	36980961
Stress Disorders Post Traumatic	Associate	25158632
Substance Related Disorders	Associate	25158632
Tremor hereditary essential 1	Associate	12882651

DRD3 (dopamine receptor D3)