Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1812
Gene name Gene Name - the full gene name approved by the HGNC.	Dopamine receptor D1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DRD1
Synonyms (NCBI Gene) Gene synonyms aliases	D1R, DADR, DRD1A
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases.

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000044	hsa-miR-504-5p	Luciferase reporter assay	19135651
MIRT000044	hsa-miR-504-5p	Luciferase reporter assay	19135651
MIRT438103	hsa-miR-382-5p	Luciferase reporter assay	23873704
MIRT438103	hsa-miR-382-5p	Luciferase reporter assay	23873704
MIRT736201	hsa-miR-15a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31858826
MIRT945293	hsa-miR-103a	CLIP-seq
MIRT945294	hsa-miR-106a	CLIP-seq
MIRT945295	hsa-miR-106b	CLIP-seq
MIRT945296	hsa-miR-107	CLIP-seq
MIRT945297	hsa-miR-142-5p	CLIP-seq
MIRT945298	hsa-miR-15a	CLIP-seq
MIRT945299	hsa-miR-15b	CLIP-seq
MIRT945300	hsa-miR-16	CLIP-seq
MIRT945301	hsa-miR-17	CLIP-seq
MIRT945302	hsa-miR-195	CLIP-seq
MIRT945303	hsa-miR-20a	CLIP-seq
MIRT945304	hsa-miR-20b	CLIP-seq
MIRT945305	hsa-miR-302a	CLIP-seq
MIRT945306	hsa-miR-302b	CLIP-seq
MIRT945307	hsa-miR-302c	CLIP-seq
MIRT945308	hsa-miR-302d	CLIP-seq
MIRT945309	hsa-miR-302e	CLIP-seq
MIRT945310	hsa-miR-330-3p	CLIP-seq
MIRT945311	hsa-miR-340	CLIP-seq
MIRT945312	hsa-miR-3609	CLIP-seq
MIRT945313	hsa-miR-372	CLIP-seq
MIRT945314	hsa-miR-373	CLIP-seq
MIRT945315	hsa-miR-3977	CLIP-seq
MIRT945316	hsa-miR-424	CLIP-seq
MIRT945317	hsa-miR-4435	CLIP-seq
MIRT945318	hsa-miR-4694-3p	CLIP-seq
MIRT945319	hsa-miR-4796-3p	CLIP-seq
MIRT945320	hsa-miR-497	CLIP-seq
MIRT945321	hsa-miR-519d	CLIP-seq
MIRT945322	hsa-miR-520a-3p	CLIP-seq
MIRT945323	hsa-miR-520b	CLIP-seq
MIRT945324	hsa-miR-520c-3p	CLIP-seq
MIRT945325	hsa-miR-520d-3p	CLIP-seq
MIRT945326	hsa-miR-520d-5p	CLIP-seq
MIRT945327	hsa-miR-520e	CLIP-seq
MIRT945328	hsa-miR-522	CLIP-seq
MIRT945329	hsa-miR-524-5p	CLIP-seq
MIRT945330	hsa-miR-548ah	CLIP-seq
MIRT945331	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TFAP2B	Unknown	10640692

Show/Hide all(114)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IBA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IDA	2144334, 2168520
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IEA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IMP	1282671, 7838121
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001661	Process	Conditioned taste aversion	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	33571431
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IDA	1831904
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15569306, 27460146, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	2144334
GO:0005886	Component	Plasma membrane	IDA	11500503, 15569306
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA	28154160
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006936	Process	Muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	1282671
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	2144334, 11500503
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	1282671, 2144334, 2168520, 7838121, 17760784, 18403039
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IMP	33571431
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IBA
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0007612	Process	Learning	IEA
GO:0007613	Process	Memory	IEA
GO:0007617	Process	Mating behavior	IEA
GO:0007617	Process	Mating behavior	ISS
GO:0007625	Process	Grooming behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007628	Process	Adult walking behavior	IEA
GO:0007628	Process	Adult walking behavior	ISS
GO:0007631	Process	Feeding behavior	IEA
GO:0008306	Process	Associative learning	IEA
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0012505	Component	Endomembrane system	IEA
GO:0014002	Process	Astrocyte development	IEA
GO:0015872	Process	Dopamine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0019226	Process	Transmission of nerve impulse	ISS
GO:0019228	Process	Neuronal action potential	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021756	Process	Striatum development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030432	Process	Peristalsis	IEA
GO:0032795	Function	Heterotrimeric G-protein binding	IDA	33571431
GO:0035106	Process	Operant conditioning	IEA
GO:0035240	Function	Dopamine binding	IEA
GO:0035240	Function	Dopamine binding	IMP	1282671
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0042053	Process	Regulation of dopamine metabolic process	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0042711	Process	Maternal behavior	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043268	Process	Positive regulation of potassium ion transport	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046959	Process	Habituation	IEA
GO:0046960	Process	Sensitization	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1282671, 7838121
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060134	Process	Prepulse inhibition	ISS
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IDA	1282671
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060170	Component	Ciliary membrane	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0097648	Component	G protein-coupled receptor complex	IMP	33571431
GO:0097730	Component	Non-motile cilium	IDA	20531939
GO:0097730	Component	Non-motile cilium	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099010	Process	Modification of postsynaptic structure	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1990763	Function	Arrestin family protein binding	IPI	33571431
GO:2001224	Process	Positive regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
126449	3020	ENSG00000184845

Protein

UniProt ID

P21728

Protein name

D(1A) dopamine receptor (Dopamine D1 receptor)

Protein function

Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.

PDB

7CKW , 7CKX , 7CKY , 7CKZ , 7CRH , 7F0T , 7F1O , 7F1Z , 7F23 , 7F24 , 7JOZ , 7JV5 , 7JVP , 7JVQ , 7LJC , 7LJD , 7X2C , 7X2D , 7X2F , 8IRR , 8JXR , 8JXS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	40 → 331	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in caudate, nucleus accumbens and in the olfactory tubercle. {ECO:0000269|PubMed:2144334}.

Sequence

MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT

Sequence length

446

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Gap junction Dopaminergic synapse Parkinson disease Cocaine addiction Amphetamine addiction Morphine addiction Alcoholism		Dopamine receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Leptin levels in type 2 diabetes	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AIDS Associated Nephropathy	Associate	24078558
Attention Deficit Disorder with Hyperactivity	Associate	24410775, 28237458
Bile Duct Neoplasms	Associate	36441110
Bipolar Disorder	Associate	28751646
Brain Injuries Traumatic	Associate	24618367
Brain Neoplasms	Associate	31123752
Breast Neoplasms	Associate	25556472
Bronchitis	Associate	37268414
Carcinoma Hepatocellular	Associate	34212175
Carcinoma Renal Cell	Associate	31478179
Cocaine Related Disorders	Associate	24078558
Cognition Disorders	Associate	24078558
Diabetes Mellitus	Associate	23133444
Diabetes Mellitus Type 2	Associate	34495077
Disruptive Impulse Control and Conduct Disorders	Associate	25896831
Endometrial Neoplasms	Associate	37437489
Ependymoma	Associate	31478179
Essential Hypertension	Associate	21797797, 28579604, 34495077
Gastrointestinal Stromal Tumors	Associate	30103756
Glioblastoma	Associate	36477472
Hallucinations	Associate	11723200
HIV Infections	Associate	24078558, 37376663
Hypertension	Associate	23133444
Kidney Diseases	Associate	19675531
Lung Neoplasms	Associate	25281486
Melanoma	Associate	31478179
Neoplasms	Associate	31478179
Neoplasms	Inhibit	37437489
Opioid Related Disorders	Associate	24078558
Osteoarthritis	Associate	32184581
Parkinson Disease	Associate	25896831, 32817461, 33348472
Parkinson Disease	Stimulate	28057070
Parkinsonism Dystonia Infantile	Associate	37048120
Personality Disorders	Associate	11723200, 24618367
Pneumonia	Associate	36693372
Psychotic Disorders	Associate	11723200
Pulmonary Disease Chronic Obstructive	Associate	37268414
Schizophrenia	Associate	29032150
Sleep Bruxism	Associate	32367059
Stiff Skin Syndrome	Associate	23133444
Substance Related Disorders	Associate	24078558

DRD1 (dopamine receptor D1)