Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	181
Gene name	Agouti related neuropeptide
Gene symbol	AGRP
Synonyms (NCBI Gene)	AGRTARTASIP2
Chromosome	16
Chromosome location	16q22.1
Summary	This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostas

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018298	hsa-miR-335-5p	Microarray	18185580

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10318826
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	15927146
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	9311920
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15927146
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IDA	15927146
GO:0005796	Component	Golgi lumen	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15927146
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9311920
GO:0007623	Process	Circadian rhythm	IEA
GO:0007631	Process	Feeding behavior	TAS	9751529
GO:0008343	Process	Adult feeding behavior	IBA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0048571	Process	Long-day photoperiodism	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060259	Process	Regulation of feeding behavior	IDA	15927146
GO:0060259	Process	Regulation of feeding behavior	IMP	9311920
GO:0070996	Function	Type 1 melanocortin receptor binding	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IEA

MIM	HGNC	e!Ensembl
602311	330	ENSG00000159723

O00253

Protein name

Agouti-related protein

Protein function

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocorti

PDB

1HYK , 1MR0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05039	Agouti	34 → 122	Agouti protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.

Sequence

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTAMNPCSRT

Sequence length

132

Interactions

View interactions

	KEGG
	Adipocytokine signaling pathway

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
AGRP-related condition	Benign	rs5030980	RCV005357092
Inherited obesity	Benign	rs5030980	RCV003992146
Leanness, inherited	Benign	rs5030980	RCV000007754
Obesity	Uncertain significance	rs145840661	RCV002486474
Obesity, late-onset	Benign	rs5030980	RCV000007753

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anorexia Nervosa	Associate	17197106, 24831852
Anxiety	Associate	33767348
Aphasia Primary Progressive	Stimulate	26377252
Behcet Syndrome	Stimulate	39191728
Bipolar Disorder	Associate	39191728
Colorectal Neoplasms	Associate	33779485
Cushing Syndrome	Stimulate	16320160
Depressive Disorder	Associate	33767348
Frontotemporal Dementia	Stimulate	26377252
Hyperphagia	Associate	36812308
Insulin Resistance	Associate	33637536
Intellectual Disability	Associate	33767348
Lymphocytosis	Associate	20404050
Metabolic Syndrome	Associate	33637536
Neoplasms	Associate	19038268
Neoplasms Adipose Tissue	Associate	20404050
Obesity	Associate	19602223, 23900445, 26226973, 36812308

AGRP (agouti related neuropeptide)