Gene Gene information from NCBI Gene database.
Entrez ID 1781
Gene name Dynein cytoplasmic 1 intermediate chain 2
Gene symbol DYNC1I2
Synonyms (NCBI Gene)
DIC74DNCI2IC2NEDMIBA
Chromosome 2
Chromosome location 2q31.1
Summary This gene encodes a member of the dynein intermediate chain family. The encoded protein is a non-catalytic component of the cytoplasmic dynein 1 complex, which acts as a retrograde microtubule motor to transport organelles and vesicles. A pseudogene of th
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs752940799 A>G Pathogenic Coding sequence variant, missense variant
rs1574594051 G>A Pathogenic Splice donor variant
rs1574596084 C>T Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
87
miRTarBase ID miRNA Experiments Reference
MIRT036037 hsa-miR-1301-3p CLASH 23622248
MIRT704094 hsa-miR-3129-3p HITS-CLIP 23313552
MIRT704093 hsa-miR-5583-5p HITS-CLIP 23313552
MIRT704092 hsa-miR-496 HITS-CLIP 23313552
MIRT704091 hsa-miR-4789-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0003777 Function Microtubule motor activity NAS 8522607
GO:0005515 Function Protein binding IPI 16189514, 24986880, 25416956, 31515488, 32296183, 33961781, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm NAS 8522607
GO:0005813 Component Centrosome IDA 21399614
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603331 2964 ENSG00000077380
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13409
Protein name Cytoplasmic dynein 1 intermediate chain 2 (Cytoplasmic dynein intermediate chain 2) (Dynein intermediate chain 2, cytosolic) (DH IC-2)
Protein function Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (PubMed:31079899). Cytoplasmic dynein
PDB 5JPW , 6F1T , 6F1U , 6F1Z , 6F38 , 6F3A , 7Z8F , 7Z8I , 7Z8J , 7Z8K , 8PQW , 8PQZ , 8PR0 , 8PR1 , 8PR2 , 8PR3 , 8PTK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11540 Dynein_IC2 133 163 Cytoplasmic dynein 1 intermediate chain 2 Family
PF00400 WD40 468 510 WD domain, G-beta repeat Repeat
Sequence
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVFSEYWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDP
SVLQLHSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVA
PKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQ
INIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYN
NNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLW
DNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQD
SMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPIT
GIHCHAAVGAVDFSHLFVTSSFDWTVKLWT
TKNNKPLYSFEDNADYVYDVMWSPTHPALF
ACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVG
EQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA
Sequence length 638
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Phagosome
Motor proteins
Vasopressin-regulated water reabsorption
Salmonella infection
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
MHC class II antigen presentation
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
RHO GTPases Activate Formins
COPI-mediated anterograde transport
COPI-independent Golgi-to-ER retrograde traffic
Mitotic Prometaphase
AURKA Activation by TPX2
HCMV Early Events
Aggrephagy
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
22
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder with microcephaly and structural brain anomalies Likely pathogenic; Pathogenic rs2105689812, rs1574594051, rs752940799, rs1574596084 RCV001781012
RCV000786848
RCV000786849
RCV000786850
Neurodevelopmental disorder with microcephaly, hypotonia, and variable brain anomalies Pathogenic rs752940799, rs1574596084 RCV001254719
RCV001254720
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs3821091 RCV005898241
DYNC1I2-related disorder Benign; Likely benign rs746910264, rs756992961, rs767705533 RCV003982352
RCV003981254
RCV003979051
RCV003979073
RCV003966824
Familial cancer of breast Benign rs3821091 RCV005898240
Hepatocellular carcinoma Benign rs3821091 RCV005898242
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38095634
Beckwith Wiedemann Syndrome Associate 25898929, 28160403, 28699632, 29602885, 34065128, 35765875
Ear Diseases Associate 25898929
Endometrial Neoplasms Associate 32412912
Fetal Growth Retardation Associate 24986528
Growth and Developmental Retardation Ocular Ptosis Cardiac Defect and Anal Atresia Associate 29602885
Hepatoblastoma Associate 28160403
Hyperinsulinism Associate 39382384
Infant Newborn Diseases Associate 25898929
Macroglossia Associate 35765875