DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1780
Gene name Gene Name - the full gene name approved by the HGNC.
Dynein cytoplasmic 1 intermediate chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DYNC1I1
Synonyms (NCBI Gene) Gene synonyms aliases
DNCI1, DNCIC1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT016726 hsa-miR-335-5p Microarray 18185580
MIRT948807 hsa-miR-155 CLIP-seq
MIRT948808 hsa-miR-3160-5p CLIP-seq
MIRT948809 hsa-miR-3671 CLIP-seq
MIRT948810 hsa-miR-4729 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 19229290
GO:0000776 Component Kinetochore IEA
GO:0000922 Component Spindle pole IDA 19229290
GO:0000922 Component Spindle pole IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603772 2963 ENSG00000158560
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O14576
Protein name Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC-1)
Protein function Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11540 Dynein_IC2 143 → 173 Cytoplasmic dynein 1 intermediate chain 2 Family
PF00400 WD40 476 → 518 WD domain, G-beta repeat Repeat
Sequence 
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA
Sequence length 645
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phagosome
Motor proteins
Vasopressin-regulated water reabsorption
Salmonella infection 		  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
MHC class II antigen presentation
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
HSP90 chaperone cycle for steroid hormone receptors (SHR)
RHO GTPases Activate Formins
COPI-mediated anterograde transport
COPI-independent Golgi-to-ER retrograde traffic
Mitotic Prometaphase
HCMV Early Events
Aggrephagy
EML4 and NUDC in mitotic spindle formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Astrocytoma N/A N/A GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 21767414, 34679093
Ectrodactyly Associate 25231166, 27291887
Glioblastoma Associate 32513296
Hearing Loss Associate 25231166, 27291887
Mitral Valve Prolapse Associate 27291887
Neoplasm Metastasis Stimulate 31605449
Paranoid Personality Disorder Associate 27291887
Spasms Infantile Associate 35830182
Stomach Neoplasms Associate 31605449