Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1780
Gene name	Dynein cytoplasmic 1 intermediate chain 1
Gene symbol	DYNC1I1
Synonyms (NCBI Gene)	DNCI1DNCIC1
Chromosome	7
Chromosome location	7q21.3

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016726	hsa-miR-335-5p	Microarray	18185580
MIRT948807	hsa-miR-155	CLIP-seq
MIRT948808	hsa-miR-3160-5p	CLIP-seq
MIRT948809	hsa-miR-3671	CLIP-seq
MIRT948810	hsa-miR-4729	CLIP-seq
MIRT948811	hsa-miR-607	CLIP-seq
MIRT2216245	hsa-miR-1264	CLIP-seq
MIRT2216246	hsa-miR-1291	CLIP-seq
MIRT2216247	hsa-miR-146b-3p	CLIP-seq
MIRT2216248	hsa-miR-328	CLIP-seq
MIRT2216249	hsa-miR-4517	CLIP-seq
MIRT2216250	hsa-miR-486-5p	CLIP-seq
MIRT2216251	hsa-miR-9	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	19229290
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IDA	19229290
GO:0000922	Component	Spindle pole	IEA
GO:0003774	Function	Cytoskeletal motor activity	TAS	10049579
GO:0003777	Function	Microtubule motor activity	ISS
GO:0005515	Function	Protein binding	IPI	14985359, 16189514, 19927128, 21900206, 23664119, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	25540360
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	25540360
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IBA
GO:0005868	Component	Cytoplasmic dynein complex	IEA
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005868	Component	Cytoplasmic dynein complex	TAS	10049579
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0010970	Process	Transport along microtubule	IBA
GO:0030286	Component	Dynein complex	IEA
GO:0030507	Function	Spectrin binding	IDA	23704327
GO:0031982	Component	Vesicle	IDA	20682791
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0045503	Function	Dynein light chain binding	IBA
GO:0045504	Function	Dynein heavy chain binding	IBA
GO:0047496	Process	Vesicle transport along microtubule	IMP	24561039
GO:0047496	Process	Vesicle transport along microtubule	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0055037	Component	Recycling endosome	IDA	24561039

MIM	HGNC	e!Ensembl
603772	2963	ENSG00000158560

O14576

Protein name

Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC-1)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11540	Dynein_IC2	143 → 173	Cytoplasmic dynein 1 intermediate chain 2	Family
PF00400	WD40	476 → 518	WD domain, G-beta repeat	Repeat

Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Sequence length

645

Interactions

View interactions

	KEGG		Reactome
	Phagosome Motor proteins Vasopressin-regulated water reabsorption Salmonella infection		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion HSP90 chaperone cycle for steroid hormone receptors (SHR) RHO GTPases Activate Formins COPI-mediated anterograde transport COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adrenocortical carcinoma, hereditary	Benign	rs3757697	RCV005914506
Colorectal cancer	Benign	rs3757697	RCV005914509
DYNC1I1-related disorder	Likely benign; Benign	rs147587226, rs78122113, rs76250658, rs376956482, rs867286355, rs185004446, rs550636387, rs145885345, rs370341645, rs41278809, rs42082, rs139485962, rs35314029, rs117676704	RCV003923696 RCV003978544 RCV003933453 RCV003950895 RCV003961740 RCV003931411 RCV003956889 RCV003954729 RCV003946812 RCV003972702 RCV003972703 RCV003960761 RCV003968008 RCV003923057
Hepatocellular carcinoma	Benign	rs42082	RCV005898239
Malignant lymphoma, large B-cell, diffuse	Benign	rs3757697	RCV005914508
Uterine carcinosarcoma	Benign	rs3757697	RCV005914510
Uveal melanoma	Benign	rs3757697	RCV005914507

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	21767414, 34679093
Ectrodactyly	Associate	25231166, 27291887
Glioblastoma	Associate	32513296
Hearing Loss	Associate	25231166, 27291887
Mitral Valve Prolapse	Associate	27291887
Neoplasm Metastasis	Stimulate	31605449
Paranoid Personality Disorder	Associate	27291887
Spasms Infantile	Associate	35830182
Stomach Neoplasms	Associate	31605449

DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1)