Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1780
Gene name Gene Name - the full gene name approved by the HGNC.	Dynein cytoplasmic 1 intermediate chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DYNC1I1
Synonyms (NCBI Gene) Gene synonyms aliases	DNCI1, DNCIC1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q21.3

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016726	hsa-miR-335-5p	Microarray	18185580
MIRT948807	hsa-miR-155	CLIP-seq
MIRT948808	hsa-miR-3160-5p	CLIP-seq
MIRT948809	hsa-miR-3671	CLIP-seq
MIRT948810	hsa-miR-4729	CLIP-seq
MIRT948811	hsa-miR-607	CLIP-seq
MIRT2216245	hsa-miR-1264	CLIP-seq
MIRT2216246	hsa-miR-1291	CLIP-seq
MIRT2216247	hsa-miR-146b-3p	CLIP-seq
MIRT2216248	hsa-miR-328	CLIP-seq
MIRT2216249	hsa-miR-4517	CLIP-seq
MIRT2216250	hsa-miR-486-5p	CLIP-seq
MIRT2216251	hsa-miR-9	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IDA	19229290
GO:0000777	Component	Condensed chromosome kinetochore	IEA
GO:0000922	Component	Spindle pole	IDA	19229290
GO:0003774	Function	Motor activity	TAS	10049579
GO:0003777	Function	Microtubule motor activity	ISS
GO:0005515	Function	Protein binding	IPI	14985359, 19927128, 23664119
GO:0005634	Component	Nucleus	IDA	25540360
GO:0005737	Component	Cytoplasm	IDA	25540360
GO:0005829	Component	Cytosol	TAS
GO:0005868	Component	Cytoplasmic dynein complex	IBA	21873635
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005874	Component	Microtubule	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	TAS
GO:0007018	Process	Microtubule-based movement	IBA	21873635
GO:0008017	Function	Microtubule binding	ISS
GO:0010970	Process	Transport along microtubule	IBA	21873635
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030507	Function	Spectrin binding	IDA	23704327
GO:0031982	Component	Vesicle	IDA	20682791
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0045503	Function	Dynein light chain binding	IBA	21873635
GO:0045504	Function	Dynein heavy chain binding	IBA	21873635
GO:0047496	Process	Vesicle transport along microtubule	IMP	24561039
GO:0047496	Process	Vesicle transport along microtubule	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0055037	Component	Recycling endosome	IDA	24561039

MIM	HGNC	e!Ensembl
603772	2963	ENSG00000158560

Protein

UniProt ID

O14576

Protein name

Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC-1)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11540	Dynein_IC2	143 → 173	Cytoplasmic dynein 1 intermediate chain 2	Family
PF00400	WD40	476 → 518	WD domain, G-beta repeat	Repeat

Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Sequence length

645

Interactions

View interactions

	KEGG		Reactome
	Phagosome Motor proteins Vasopressin-regulated water reabsorption Salmonella infection		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion HSP90 chaperone cycle for steroid hormone receptors (SHR) RHO GTPases Activate Formins COPI-mediated anterograde transport COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	30664745

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Astrocytoma	Astrocytoma			GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Hepatocellular	Associate	21767414, 34679093
Ectrodactyly	Associate	25231166, 27291887
Glioblastoma	Associate	32513296
Hearing Loss	Associate	25231166, 27291887
Mitral Valve Prolapse	Associate	27291887
Neoplasm Metastasis	Stimulate	31605449
Paranoid Personality Disorder	Associate	27291887
Spasms Infantile	Associate	35830182
Stomach Neoplasms	Associate	31605449

DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1)