DNASE1L2 (deoxyribonuclease 1 like 2)

Gene

• Entrez ID: 1775
• Gene name: Deoxyribonuclease 1 like 2
• Gene symbol: DNASE1L2
• Synonyms (NCBI Gene): DNAS1L2
• Chromosome: 16
• Chromosome location: 16p13.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001942	Process	Hair follicle development	IEA
GO:0003335	Process	Corneocyte development	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	TAS	9205125
GO:0003824	Function	Catalytic activity	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004530	Function	Deoxyribonuclease I activity	IBA
GO:0004536	Function	DNA nuclease activity	IEA
GO:0004536	Function	DNA nuclease activity	TAS	9205125
GO:0005509	Function	Calcium ion binding	TAS	9205125
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006259	Process	DNA metabolic process	TAS	9205125
GO:0006308	Process	DNA catabolic process	IBA
GO:0006308	Process	DNA catabolic process	IEA
GO:0006308	Process	DNA catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 602622
• HGNC: 2958
• e!Ensembl: ENSG00000167968

Protein

• UniProt ID: Q92874
• Protein name: Deoxyribonuclease-1-like 2 (EC 3.1.21.-) (DNase I homolog protein DHP1) (Deoxyribonuclease I-like 2) (DNase I-like 2)
• Protein function: Divalent cation-dependent acid DNA endonuclease involved in the breakdown of the nucleus during corneocyte formation of epidermal keratinocytes. May play an immune role by eliminating harmful DNA released into the extracellular environment by da
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03372	Exo_endo_phos	25 → 288	Endonuclease/Exonuclease/phosphatase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in the skin and up-regulated during keratinocytes differentiation. Highly abundant (at protein level) in the stratum granulosum. {ECO:0000269|PubMed:16902420}.
• Sequence:

  MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQE
  VRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPD
  PEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEI
  DALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTV
  GNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR

• Sequence length: 299