Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1758
Gene name Gene Name - the full gene name approved by the HGNC.	Dentin matrix acidic phosphoprotein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DMP1
Synonyms (NCBI Gene) Gene synonyms aliases	ARHP, ARHR, DMP-1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cell

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893834	A>G,T	Pathogenic	Missense variant, initiator codon variant, coding sequence variant

Show/Hide all(22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736513	hsa-miR-708-5p	Western blotting, Microarray, qRT-PCR, Flow cytometry	32952566
MIRT736515	hsa-miR-642a-5p	Western blotting, Microarray, qRT-PCR, Flow cytometry	32952566
MIRT939145	hsa-miR-1200	CLIP-seq
MIRT939146	hsa-miR-1236	CLIP-seq
MIRT939147	hsa-miR-150	CLIP-seq
MIRT939148	hsa-miR-3156-3p	CLIP-seq
MIRT939149	hsa-miR-4299	CLIP-seq
MIRT939150	hsa-miR-4301	CLIP-seq
MIRT939151	hsa-miR-4456	CLIP-seq
MIRT939152	hsa-miR-4687-3p	CLIP-seq
MIRT939153	hsa-miR-4713-5p	CLIP-seq
MIRT939154	hsa-miR-483-3p	CLIP-seq
MIRT939155	hsa-miR-532-3p	CLIP-seq
MIRT939156	hsa-miR-548q	CLIP-seq
MIRT939157	hsa-miR-597	CLIP-seq
MIRT939158	hsa-miR-647	CLIP-seq
MIRT939159	hsa-miR-668	CLIP-seq
MIRT2213170	hsa-miR-4290	CLIP-seq
MIRT2213171	hsa-miR-4469	CLIP-seq
MIRT2213172	hsa-miR-4655-3p	CLIP-seq
MIRT2213173	hsa-miR-4687-5p	CLIP-seq
MIRT2213174	hsa-miR-4786-3p	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001503	Process	Ossification	TAS	8509401
GO:0005178	Function	Integrin binding	TAS	8509401
GO:0005509	Function	Calcium ion binding	TAS	8509401
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	TAS	8509401
GO:0031214	Process	Biomineral tissue development	IEA
GO:0050840	Function	Extracellular matrix binding	IBA
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0070173	Process	Regulation of enamel mineralization	IEA

MIM	HGNC	e!Ensembl
600980	2932	ENSG00000152592

Protein

UniProt ID

Q13316

Protein name

Dentin matrix acidic phosphoprotein 1 (DMP-1) (Dentin matrix protein 1)

Protein function

May have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteob

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07263	DMP1	1 → 513	Dentin matrix protein 1 (DMP1)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in tooth particularly in odontoblast, ameloblast and cementoblast.

Sequence

MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEE
QANEDPSDSTQSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSG
PGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEG
GDSTQESESEEHWVGGGSDGESSHGDGSELDDEGMQSDDPESIRSERGNSRMNSAGMKSK
ESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSN
SRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVV
SESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQ
LKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGY

Sequence length

513

Interactions

View interactions

	KEGG		Reactome
	ECM-receptor interaction		ECM proteoglycans Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hypophosphatemic Rickets	hypophosphatemic rickets, autosomal recessive, 1, hypophosphatemic rickets	rs587776696, rs587776697, rs587776698, rs899142959	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	30735719
Adenocarcinoma	Associate	12929940, 27331624
Adenocarcinoma Bronchiolo Alveolar	Associate	12929940
Bone Diseases Metabolic	Associate	24747200
Breast Neoplasms	Associate	23045280
Carcinoma Non Small Cell Lung	Associate	12929940
Carcinoma Squamous Cell	Associate	12929940
Cartilage Diseases	Associate	15001995
Choroidal Neovascularization	Inhibit	21190990
Dentinogenesis Imperfecta	Associate	25578972
Familial Hypophosphatemic Rickets	Associate	23325605, 28880715, 36315908, 36849506
Hantavirus Infections	Associate	30735719
HEM dysplasia	Associate	20499351
Hemorrhagic Fever with Renal Syndrome	Associate	30735719
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23045280
Hypophosphatasia	Inhibit	22703652
Hypophosphatemia	Associate	19796717
Hypophosphatemic Rickets Autosomal Recessive 1	Associate	17033625, 19796717, 20499351
Hypophosphatemic Rickets Autosomal Recessive 2	Associate	19007919, 36315908
Hypoxia	Stimulate	37929653
Iron Overload	Stimulate	38040893
Leukemia Myeloid Acute	Associate	29556023
Lung Neoplasms	Associate	12929940, 33120969
Malignant mesenchymal tumor	Associate	15001995
Neoplasm Metastasis	Associate	12929940
Neoplasms	Associate	12929940, 15001995, 23045280, 38164262
Neoplasms	Inhibit	21190990
Neoplastic Syndromes Hereditary	Associate	29505567
Oliguria	Stimulate	30735719
Oncogenic osteomalacia	Associate	15001995
Osseous Heteroplasia Progressive	Associate	26960368
Osteoma Osteoid	Associate	19679205
Renal Insufficiency Chronic	Stimulate	19679205
Rickets	Associate	21050253, 23325605
Rickets Hypophosphatemic	Associate	20137772, 20137773, 21050253, 22695891, 36482408
Silicosiderosis	Associate	24747200, 26960368
Spondylitis Ankylosing	Associate	26960368

DMP1 (dentin matrix acidic phosphoprotein 1)