Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1755
Gene name Gene Name - the full gene name approved by the HGNC.	Deleted in malignant brain tumors 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DMBT1
Synonyms (NCBI Gene) Gene synonyms aliases	GP340, SAG, SALSA, muclin
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.13
Summary Summary of gene provided in NCBI Entrez Gene.	Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. This gene was originally isolated based on its deletion in a medulloblastoma cell line. This gene is expressed with transcripts of 6.0, 7.5, and 8.0 kb

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT939039	hsa-miR-197	CLIP-seq
MIRT939040	hsa-miR-5096	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005044	Function	Scavenger receptor activity	NAS	9288095
GO:0005044	Function	Scavenger receptor activity	TAS	10485905
GO:0005515	Function	Protein binding	IPI	10101009, 14676191
GO:0005576	Component	Extracellular region	TAS	14732920
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	10485905
GO:0006897	Process	Endocytosis	IEA
GO:0006952	Process	Defense response	IBA	21873635
GO:0007275	Process	Multicellular organism development	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016032	Process	Viral process	IEA
GO:0019898	Component	Extrinsic component of membrane	ISS
GO:0030670	Component	Phagocytic vesicle membrane	IDA	10485905
GO:0030855	Process	Epithelial cell differentiation	NAS	14676191
GO:0030855	Process	Epithelial cell differentiation	TAS	14732920
GO:0031012	Component	Extracellular matrix	IBA	21873635
GO:0035375	Function	Zymogen binding	ISS
GO:0038187	Function	Pattern recognition receptor activity	TAS	12681477
GO:0042494	Process	Detection of bacterial lipoprotein	IBA	21873635
GO:0042589	Component	Zymogen granule membrane	ISS
GO:0043152	Process	Induction of bacterial agglutination	TAS	14732920
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045087	Process	Innate immune response	TAS	10485905
GO:0048306	Function	Calcium-dependent protein binding	TAS	10485905
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0050840	Function	Extracellular matrix binding	IBA	21873635
GO:0051607	Process	Defense response to virus	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
601969	2926	ENSG00000187908

Protein

UniProt ID

Q9UGM3

Protein name

Scavenger receptor cysteine-rich domain-containing protein DMBT1 (Deleted in malignant brain tumors 1 protein) (Glycoprotein 340) (Gp-340) (Hensin) (Salivary agglutinin) (SAG) (Surfactant pulmonary-associated D-binding protein)

Protein function

May be considered as a candidate tumor suppressor gene for brain, lung, esophageal, gastric, and colorectal cancers. May play roles in mucosal defense system, cellular immune defense and epithelial differentiation. May play a role as an opsonin

PDB

6SA4 , 6SA5 , 6SAN , 8J8D , 8J8T , 8WZS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00530	SRCR	105 → 202	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	237 → 334	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	366 → 463	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	497 → 594	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	605 → 702	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	736 → 833	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	865 → 962	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	996 → 1093	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	1125 → 1222	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	1254 → 1351	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	1383 → 1480	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	1512 → 1609	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	1643 → 1740	Scavenger receptor cysteine-rich domain	Domain
PF00431	CUB	1766 → 1874	CUB domain	Domain
PF00530	SRCR	1889 → 1986	Scavenger receptor cysteine-rich domain	Domain
PF00431	CUB	2008 → 2114	CUB domain	Domain
PF00100	Zona_pellucida	2127 → 2379	Zona pellucida-like domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in alveolar and macrophage tissues. In some macrophages, expression is seen on the membrane, and in other macrophages, strongly expressed in the phagosome/phagolysosome compartments. Expressed in lung, trachea, salivar

Sequence

MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGG
DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
VRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTIT
LPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWA
MLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSL
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQG
SGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITL
PPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAT
SAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT
PSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVI
CSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDD
SWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSH
NCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYR
GSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRC
QGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
SGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLAL
RLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSG
PIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRAST
AGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG
NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPD
TWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQ
LGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICS
ATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEVNS
GYRINLGFSNLKLEAHHNCSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFR
SDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEA
EVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHRED
AGVICSGNHLSTPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEV
QNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFI
SDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYY
ECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRM
LQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQ
DLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIA
RFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVLRSKRDVGSYQEKVDVVLGPI
QLQTPPRREEEPR

Sequence length

2413

Interactions

View interactions

	KEGG		Reactome
	Salivary secretion		Surfactant metabolism

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925
Glioma	Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499 View all (13 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Myocardial Infarction	Myocardial Infarction			GWAS

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenomatous Polyposis Coli	Associate	37565794
Allergic Fungal Sinusitis	Associate	33755113
Brain Neoplasms	Associate	10551316, 11563989, 23439307, 29287594, 9888459
Brain Neoplasms	Inhibit	23691218
Breast Neoplasms	Inhibit	15301691
Breast Neoplasms	Associate	23107584, 29287594, 32734521
Carcinogenesis	Associate	10551316
Carcinoma Squamous Cell	Associate	31400059, 38037123
Colitis	Associate	26813944
Colitis Ulcerative	Associate	23691218, 37322958
Colorectal Neoplasms	Associate	27182161
Colorectal Neoplasms	Inhibit	9888459
COVID 19	Associate	40149929
Craniosynostoses	Associate	33755113
Crohn Disease	Associate	17548659, 19189310, 20155851, 23691218, 24223725
Dental Caries	Associate	11007786, 11563989, 17562017
Dry Eye Syndromes	Associate	27436115
Duodenal Neoplasms	Associate	37565794
Endocarditis Bacterial	Stimulate	19698862
Esophageal Squamous Cell Carcinoma	Inhibit	9888459
Ganglioglioma	Associate	18371186
Gastritis	Associate	11007786
Gastrointestinal Neoplasms	Associate	9888459
Glioblastoma	Associate	10433932, 11438483, 15494095
Glioma	Associate	11438483, 37115922
Head and Neck Neoplasms	Associate	34717154
Hypoxia	Inhibit	23122428
Infant Newborn Diseases	Associate	11007786
Infections	Associate	18641344
Infections	Stimulate	23034003
Infections	Inhibit	28489917
Inflammation	Associate	23691218
Inflammatory Bowel Diseases	Associate	23691218, 24223725
Intestinal Diseases	Associate	22944598
Lung Diseases	Associate	17908325
Lung Neoplasms	Inhibit	10551316
Lung Neoplasms	Associate	23122428
Lymphatic Metastasis	Associate	31400059
Melanoma	Associate	30672666
Neoplasm Metastasis	Associate	30672666
Neoplasms	Inhibit	11438483, 11563989, 15301691, 22944598, 30672666, 34717154, 34769520, 36352274, 9888459
Neoplasms	Associate	18641344, 21483804, 23107584, 37565794
Oligodendroglioma	Associate	11438483
Oropharyngeal Neoplasms	Associate	36378845
Ovarian Diseases	Associate	24390223
Pancreatic Intraductal Neoplasms	Associate	18849643
Pancreatic Neoplasms	Stimulate	18849643
Peptic Ulcer	Associate	11007786
Periodontal Diseases	Associate	29610270
Persistent Vegetative State	Associate	19698862
Polyps	Associate	33755113
Precancerous Conditions	Associate	27182161
Pseudomonas Infections	Associate	28489917
Pterygium	Inhibit	34769520
Respiratory Distress Syndrome	Associate	17908325
Respiratory System Abnormalities	Associate	11007786
Stomach Diseases	Inhibit	9888459
Stomach Neoplasms	Associate	22944598, 26911362
Stomach Neoplasms	Inhibit	9888459
Thrombosis	Associate	19698862

DMBT1 (deleted in malignant brain tumors 1)