Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1750
Gene name Gene Name - the full gene name approved by the HGNC.
Distal-less homeobox 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLX6
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019311 hsa-miR-148b-3p Microarray 17612493
MIRT049253 hsa-miR-92a-3p CLASH 23622248
MIRT452367 hsa-miR-4428 PAR-CLIP 20371350
MIRT452365 hsa-miR-6758-5p PAR-CLIP 20371350
MIRT452364 hsa-miR-6856-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600030 2919 ENSG00000006377
Protein
UniProt ID P56179
Protein name Homeobox protein DLX-6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 50 106 Homeodomain Domain
Sequence
MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQ
LQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK
LLKQGSNPHESDPL
QGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Sequence length 175
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Autism Spectrum Disorder autism spectrum disorder N/A N/A GenCC
Gastroesophageal Reflux Disease Gastroesophageal reflux disease N/A N/A GWAS
Split-Hand-Foot Malformation split hand-foot malformation N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35668376
Astrocytoma Associate 32108034
Auriculo condylar syndrome Associate 22560091
Autism Spectrum Disorder Associate 28321286
Breast Neoplasms Associate 35668376
Carcinogenesis Associate 28881158
Carcinoma Adenoid Cystic Associate 26953815
Carcinoma Hepatocellular Associate 30805988, 36204642
Carcinoma Ovarian Epithelial Associate 31081076
Carcinoma Renal Cell Associate 28881158