Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1748
Gene name Gene Name - the full gene name approved by the HGNC.
Distal-less homeobox 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLX4
Synonyms (NCBI Gene) Gene synonyms aliases
BP1, DLX7, DLX8, DLX9, OFC15
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs869025279 G>-,GG Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039137 hsa-miR-769-3p CLASH 23622248
MIRT573291 hsa-miR-6819-3p PAR-CLIP 20371350
MIRT573290 hsa-miR-6877-3p PAR-CLIP 20371350
MIRT573289 hsa-miR-95-5p PAR-CLIP 20371350
MIRT573288 hsa-miR-2114-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11909945
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11909945
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601911 2917 ENSG00000108813
Protein
UniProt ID Q92988
Protein name Homeobox protein DLX-4 (Beta protein 1) (Homeobox protein DLX-7) (Homeobox protein DLX-8)
Protein function May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 118 174 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver. {ECO:0000269|PubMed:11069021, ECO:0000269|PubMed:11909945}.
Sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYT
EPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKP
RTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK
LLKQNS
GGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Sequence length 240
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Orofacial Cleft orofacial cleft 15 N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 22143938
Breast Neoplasms Associate 17854498, 23091415, 24947980
Breast Neoplasms Stimulate 19119308
Carcinogenesis Associate 15161049
Carcinoma Ductal Breast Associate 17854498
Carcinoma Renal Cell Associate 31739630, 35983409
Dental Caries Associate 34311721
Gestational Trophoblastic Disease Associate 39632297
Hereditary Breast and Ovarian Cancer Syndrome Associate 23222298
Leukemia Associate 23091415, 26753961, 9096378