Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1747
Gene name Gene Name - the full gene name approved by the HGNC.
Distal-less homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLX3
Synonyms (NCBI Gene) Gene synonyms aliases
AI4, TDO
Disease Acronyms (UniProt) Disease acronyms from UniProt database
AI4, TDO
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387906405 CCCC>- Pathogenic Frameshift variant, coding sequence variant
rs387906406 AG>- Pathogenic Frameshift variant, coding sequence variant
rs1057518764 C>-,CC Likely-pathogenic, pathogenic Frameshift variant, coding sequence variant
rs1555617226 C>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT624141 hsa-miR-33a-3p HITS-CLIP 23824327
MIRT624139 hsa-miR-4307 HITS-CLIP 23824327
MIRT624137 hsa-miR-1305 HITS-CLIP 23824327
MIRT624136 hsa-miR-335-3p HITS-CLIP 23824327
MIRT624141 hsa-miR-33a-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600525 2916 ENSG00000064195
Protein
UniProt ID O60479
Protein name Homeobox protein DLX-3
Protein function Transcriptional activator (By similarity). Activates transcription of GNRHR, via binding to the downstream activin regulatory element (DARE) in the gene promoter (By similarity).
PDB 4XRS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12413 DLL_N 27 108 Homeobox protein distal-less-like N terminal Family
PF00046 Homeodomain 130 186 Homeodomain Domain
Sequence
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTV
NPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDP
VSVKEEPEAEVR
MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNR
RSKFKK
LYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS
PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Sequence length 287
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Amelogenesis imperfecta Amelogenesis Imperfecta, Amelogenesis Imperfecta, Type IV rs267607178, rs143816093, rs606231351, rs137854435, rs137854440, rs137854441, rs137854444, rs587776587, rs121908109, rs587776588, rs140213840, rs104894704, rs387906487, rs387906488, rs387906489
View all (70 more)
23949819, 15666299, 26762616
Amelogenesis imperfecta with taurodontism Amelogenesis imperfecta, hypomaturation hypoplasia type with taurodontism rs387906406, rs1057518764 15666299
Trichodentoosseous syndrome Tricho-dento-osseous syndrome (disorder), Tricho-dento-osseous syndrome rs387906405, rs387906406 22969805, 18492670, 26762616, 23949819
Associations from Text Mining
Disease Name Relationship Type References
Ameloblastoma Associate 18854600
Amelogenesis Imperfecta Associate 16674655, 30095208
Autism Spectrum Disorder Associate 28533516
Autistic Disorder Associate 27562213
Bone Diseases Metabolic Associate 33655330
Carcinogenesis Associate 31331058
Dental Caries Associate 34311721
Developmental Dysplasia of the Hip Associate 19756907
Neoplasms Squamous Cell Associate 31331058
Odontogenic Tumors Associate 18854600, 36344906