DIO3 (iodothyronine deiodinase 3)

Gene

• Entrez ID: 1735
• Gene name: Iodothyronine deiodinase 3
• Gene symbol: DIO3
• Synonyms (NCBI Gene): 5DIII, D3, DIOIII, TXDI3
• Chromosome: 14
• Chromosome location: 14q32.31
• Summary: The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family. It catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3`,5-triiodothyronine (T3)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT936621	hsa-let-7a	CLIP-seq
MIRT936622	hsa-let-7b	CLIP-seq
MIRT936623	hsa-let-7c	CLIP-seq
MIRT936624	hsa-let-7d	CLIP-seq
MIRT936625	hsa-let-7e	CLIP-seq
MIRT936626	hsa-let-7f	CLIP-seq
MIRT936627	hsa-let-7g	CLIP-seq
MIRT936628	hsa-let-7i	CLIP-seq
MIRT936629	hsa-miR-1206	CLIP-seq
MIRT936630	hsa-miR-1321	CLIP-seq
MIRT936631	hsa-miR-1915	CLIP-seq
MIRT936632	hsa-miR-3175	CLIP-seq
MIRT936633	hsa-miR-4270	CLIP-seq
MIRT936634	hsa-miR-4441	CLIP-seq
MIRT936635	hsa-miR-4445	CLIP-seq
MIRT936636	hsa-miR-4458	CLIP-seq
MIRT936637	hsa-miR-4500	CLIP-seq
MIRT936638	hsa-miR-4726-3p	CLIP-seq
MIRT936639	hsa-miR-4739	CLIP-seq
MIRT936640	hsa-miR-4756-5p	CLIP-seq
MIRT936641	hsa-miR-935	CLIP-seq
MIRT936642	hsa-miR-98	CLIP-seq
MIRT1977151	hsa-miR-1301	CLIP-seq
MIRT1977152	hsa-miR-3162-3p	CLIP-seq
MIRT1977153	hsa-miR-3614-5p	CLIP-seq
MIRT1977154	hsa-miR-3616-3p	CLIP-seq
MIRT1977155	hsa-miR-3944-5p	CLIP-seq
MIRT1977156	hsa-miR-4660	CLIP-seq
MIRT1977157	hsa-miR-4721	CLIP-seq
MIRT1977158	hsa-miR-4734	CLIP-seq
MIRT1977159	hsa-miR-5047	CLIP-seq
MIRT1977160	hsa-miR-593	CLIP-seq
MIRT1977161	hsa-miR-647	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004800	Function	Thyroxine 5'-deiodinase activity	IBA
GO:0004800	Function	Thyroxine 5'-deiodinase activity	IEA
GO:0004800	Function	Thyroxine 5'-deiodinase activity	NAS	7593630
GO:0004800	Function	Thyroxine 5'-deiodinase activity	TAS
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0033798	Function	Thyroxine 5-deiodinase activity	IDA	12746313, 18566113
GO:0033798	Function	Thyroxine 5-deiodinase activity	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042403	Process	Thyroid hormone metabolic process	IBA
GO:0042403	Process	Thyroid hormone metabolic process	IGI	26305885
GO:0042403	Process	Thyroid hormone metabolic process	TAS
GO:0042404	Process	Thyroid hormone catabolic process	IDA	12746313
GO:0042404	Process	Thyroid hormone catabolic process	IEA
GO:0042446	Process	Hormone biosynthetic process	IEA
GO:0046549	Process	Retinal cone cell development	IEA
GO:0070342	Process	Brown fat cell proliferation	IEA
GO:0097474	Process	Retinal cone cell apoptotic process	IEA

Other IDs

• MIM: 601038
• HGNC: 2885
• e!Ensembl: ENSG00000197406

Protein

• UniProt ID: P55073
• Protein name: Thyroxine 5-deiodinase (EC 1.21.99.3) (5DIII) (DIOIII) (Type 3 DI) (Type III iodothyronine deiodinase)
• Protein function: Plays a crucial role in the metabolism of thyroid hormones (TH) and has specific roles in TH activation and inactivation by deiodination (PubMed:7593630, PubMed:12586771, PubMed:12746313, PubMed:18821722). Catalyzes the deiodination of L-thyroxi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00837	T4_deiodinase	38 → 293	Iodothyronine deiodinase	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta and several fetal tissues. {ECO:0000269|PubMed:7593630}.
• Sequence:

  MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLW
  LLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHG
  QKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAF
  QRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCA
  LVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGAR
  PRRV

• Sequence length: 304

Pathways

KEGG:

Thyroid hormone signaling pathway

Reactome:

Regulation of thyroid hormone activity