Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1725
Gene name Gene Name - the full gene name approved by the HGNC.	Deoxyhypusine synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DHPS
Synonyms (NCBI Gene) Gene synonyms aliases	DHS, DS, MIG13, NEDSSWI
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs758100382	T>C	Uncertain-significance, pathogenic	5 prime UTR variant, coding sequence variant, non coding transcript variant, missense variant
rs1306390986	T>C	Pathogenic, uncertain-significance	5 prime UTR variant, initiator codon variant, non coding transcript variant, genic upstream transcript variant, upstream transcript variant, missense variant

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045190	hsa-miR-186-5p	CLASH	23622248

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14622290, 16189514, 19060904, 23602568, 24722188, 25416956, 25852190, 26496610, 28514442, 31980649, 32296183, 32707033, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006412	Process	Translation	TAS	7673224
GO:0008216	Process	Spermidine metabolic process	IBA
GO:0008216	Process	Spermidine metabolic process	IDA	23525104
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8549832
GO:0016740	Function	Transferase activity	IEA
GO:0034038	Function	Deoxyhypusine synthase activity	IBA
GO:0034038	Function	Deoxyhypusine synthase activity	IDA	8549832, 23525104, 30661771
GO:0034038	Function	Deoxyhypusine synthase activity	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0046203	Process	Spermidine catabolic process	IEA
GO:0051604	Process	Protein maturation	IDA	23525104

MIM	HGNC	e!Ensembl
600944	2869	ENSG00000095059

Protein

UniProt ID

P49366

Protein name

Deoxyhypusine synthase (DHS) (EC 2.5.1.46)

Protein function

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a critical lysine residue of the eIF-5A precursor protein to form the intermediate deox

PDB

1DHS , 1RLZ , 1ROZ , 1RQD , 6P4V , 6PGR , 6WKZ , 6WL6 , 6XXH , 6XXI , 6XXJ , 6XXK , 6XXL , 6XXM , 7A6S , 7A6T , 8A0E , 8A0F , 8A0G , 8PVU , 8R3U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01916	DS	44 → 354	Deoxyhypusine synthase	Domain

Sequence

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFG
RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLV
QHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFE
DWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS
LGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGA
DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKMD
AFMHEKNED

Sequence length

369

Interactions

View interactions

	Reactome
			Hypusine synthesis from eIF5A-lysine

DHPS (deoxyhypusine synthase)