PTCRA (pre T cell antigen receptor alpha)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
171558
Gene name Gene Name - the full gene name approved by the HGNC.
Pre T cell antigen receptor alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PTCRA
Synonyms (NCBI Gene) Gene synonyms aliases
IMD126, PT-ALPHA, PTA
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a single-pass type I membrane protein that is found in immmature but not mature T-cells. Along with TCRB and CD3 complex, the encoded protein forms the pre-T-cell receptor complex, which regulates early T-cell developme
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22795130
GO:0005886 Component Plasma membrane IDA 38422122
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0046632 Process Alpha-beta T cell differentiation IMP 38422122
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606817 21290 ENSG00000171611
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q6ISU1
Protein name Pre T-cell antigen receptor alpha (pT-alpha) (pTa) (pT-alpha-TCR)
Protein function Component of the pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) that has a crucial role in early T-cell development, particularly alpha-beta T cell differentiation.
PDB 3OF6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15028 PTCRA 20 → 146 Pre-T-cell antigen receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow. {ECO:0000269|PubMed:8618853, ECO:0000269|PubMed:8760805}.
Sequence 
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSP
IWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRST
QPMHLSGEASTARTCPQEPLRGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLP
SPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYL
SSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA
Sequence length 281
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Notch signaling pathway
Transcriptional misregulation in cancer 		 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Leukemia Associate 20208138
Leukemia Myelogenous Chronic BCR ABL Positive Associate 26822197
Leukemia Promyelocytic Acute Associate 16857994
Leukemia T Cell Associate 20208138
Lymphoma Follicular Associate 20208138
Neoplasms Associate 1845894, 20430720, 26822197
Pituitary Neoplasms Associate 20430720
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 12446444
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 20208138
Salivary Gland Neoplasms Stimulate 1845894