Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	170680
Gene name Gene Name - the full gene name approved by the HGNC.	Psoriasis susceptibility 1 candidate 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSORS1C2
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf17, SPR1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005575	Component	Cellular_component	ND
GO:0005576	Component	Extracellular region	IEA
GO:0008150	Process	Biological_process	ND

MIM	HGNC	e!Ensembl
613526	17199	ENSG00000204538

Protein

UniProt ID

Q9UIG4

Protein name

Psoriasis susceptibility 1 candidate gene 2 protein (Protein SPR1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15356	SPR1	23 → 136	Psoriasis susceptibility locus 2	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin. Also expressed in heart and skeletal muscle. {ECO:0000269|PubMed:12930300}.

Sequence

MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN
RPQEEPDLDPPREEYR

Sequence length

136

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	23955597
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	30626913

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Major Depressive Disorder	30626913	ClinVar
Psoriasis	Psoriasis		GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Inhibit	10501656
Depressive Disorder	Associate	30626913
Dermatitis Atopic	Inhibit	35462437
Hematologic Neoplasms	Associate	23955597
Leprosy	Associate	34879060
Mental Disorders	Associate	30626913
Multiple Myeloma	Associate	23955597
Muscular Atrophy Spinal	Associate	37455203
Neoplasms	Associate	10501656
Periodontitis	Inhibit	27531006
Schizophrenia	Associate	30626913

PSORS1C2 (psoriasis susceptibility 1 candidate 2)