Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	170680
Gene name	Psoriasis susceptibility 1 candidate 2
Gene symbol	PSORS1C2
Synonyms (NCBI Gene)	C6orf17SPR1
Chromosome	6
Chromosome location	6p21.33

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq

Show/Hide all (2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA

MIM	HGNC	e!Ensembl
613526	17199	ENSG00000204538

Q9UIG4

Protein name

Psoriasis susceptibility 1 candidate gene 2 protein (Protein SPR1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15356	SPR1	23 → 136	Psoriasis susceptibility locus 2	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin. Also expressed in heart and skeletal muscle. {ECO:0000269|PubMed:12930300}.

Sequence

MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN
RPQEEPDLDPPREEYR

Sequence length

136

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIV INFECTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIV-1 INFECTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Inhibit	10501656	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	30626913	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Inhibit	35462437	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	23955597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Associate	34879060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	30626913	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	23955597	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Atrophy Spinal	Associate	37455203	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10501656	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Inhibit	27531006	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	30626913	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

PSORS1C2 (psoriasis susceptibility 1 candidate 2)