S100Z (S100 calcium binding protein Z)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
170591
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein Z
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100Z
Synonyms (NCBI Gene) Gene synonyms aliases
Gm625, S100-zeta
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT017307 hsa-miR-335-5p Microarray 18185580
MIRT1324326 hsa-miR-3160-5p CLIP-seq
MIRT1324327 hsa-miR-3943 CLIP-seq
MIRT1324328 hsa-miR-515-5p CLIP-seq
MIRT2096223 hsa-miR-3202 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11747429
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 11747429, 32296183
GO:0042802 Function Identical protein binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
610103 30367 ENSG00000171643
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q8WXG8
Protein name Protein S100-Z (S100 calcium-binding protein Z)
PDB 5HYD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 → 47 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest level of expression in spleen and leukocytes. {ECO:0000269|PubMed:11747429}.
Sequence 
MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQ
DLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Sequence length 99
Interactions View interactions
<