Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
170482
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 4 member C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC4C
Synonyms (NCBI Gene) Gene synonyms aliases
BDCA-2, BDCA2, CD303, CLECSF11, CLECSF7, DLEC, HECL, PRO34150
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT896030 hsa-miR-2909 CLIP-seq
MIRT896031 hsa-miR-4278 CLIP-seq
MIRT896032 hsa-miR-4688 CLIP-seq
MIRT896033 hsa-miR-494 CLIP-seq
MIRT896034 hsa-miR-502-5p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
TCF4 Activation 20483924
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606677 13258 ENSG00000198178
Protein
UniProt ID Q8WTT0
Protein name C-type lectin domain family 4 member C (Blood dendritic cell antigen 2) (BDCA-2) (C-type lectin superfamily member 7) (Dendritic lectin) (CD antigen CD303)
Protein function Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells (PubMed:11748283, PubMed:21880719, PubMed:25995448). Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the t
PDB 3WBP , 3WBQ , 3WBR , 4ZES , 4ZET
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 100 208 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha. {ECO:0000269|PubMed:11
Sequence
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLRE
YQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVV
INTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERC
AIINFRSSEEWGWNDIHCHVPQKSICKM
KKIYI
Sequence length 213
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Dectin-2 family
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Amyotrophic Lateral Sclerosis amyotrophic lateral sclerosis N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 26943047
Amyotrophic Lateral Sclerosis 2 Juvenile Associate 26943047
Arthritis Juvenile Associate 37445800
Autoimmune Diseases Associate 21880719
Bone Marrow Diseases Associate 29415975
COVID 19 Associate 35995775
Dermatitis Stimulate 32954523
Inflammation Stimulate 18671865
Inflammation Associate 30645203, 34359833
Leukemia Myeloid Acute Associate 23616009, 31876105, 33054115