CLEC4C (C-type lectin domain family 4 member C)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 170482
Gene name C-type lectin domain family 4 member C
Gene symbol CLEC4C
Synonyms (NCBI Gene)
BDCA-2BDCA2CD303CLECSF11CLECSF7DLECHECLPRO34150
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT896030 hsa-miR-2909 CLIP-seq
MIRT896031 hsa-miR-4278 CLIP-seq
MIRT896032 hsa-miR-4688 CLIP-seq
MIRT896033 hsa-miR-494 CLIP-seq
MIRT896034 hsa-miR-502-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
TCF4 Activation 20483924
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606677 13258 ENSG00000198178
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WTT0
Protein name C-type lectin domain family 4 member C (Blood dendritic cell antigen 2) (BDCA-2) (C-type lectin superfamily member 7) (Dendritic lectin) (CD antigen CD303)
Protein function Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells (PubMed:11748283, PubMed:21880719, PubMed:25995448). Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the t
PDB 3WBP , 3WBQ , 3WBR , 4ZES , 4ZET
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 100 → 208 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha. {ECO:0000269|PubMed:11
Sequence 
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLRE
YQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVV
INTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERC
AIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Sequence length 213
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  Reactome
    Dectin-2 family
Neutrophil degranulation