Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
170302
Gene name Gene Name - the full gene name approved by the HGNC.
Aristaless related homeobox
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARX
Synonyms (NCBI Gene) Gene synonyms aliases
CT121, EIEE1, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protei
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28935479 C>T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs28936077 A>G Pathogenic Coding sequence variant, missense variant
rs104894740 G>A Pathogenic Coding sequence variant, stop gained
rs104894741 A>T Pathogenic Coding sequence variant, missense variant
rs104894743 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017028 hsa-miR-335-5p Microarray 18185580
MIRT801507 hsa-miR-1208 CLIP-seq
MIRT801508 hsa-miR-1275 CLIP-seq
MIRT801509 hsa-miR-302a CLIP-seq
MIRT801510 hsa-miR-302b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 22194193
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 22194193, 31691806
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300382 18060 ENSG00000004848
Protein
UniProt ID Q96QS3
Protein name Homeobox protein ARX (Aristaless-related homeobox)
Protein function Transcription factor (PubMed:22194193, PubMed:31691806). Binds to specific sequence motif 5'-TAATTA-3' in regulatory elements of target genes, such as histone demethylase KDM5C (PubMed:22194193, PubMed:31691806). Positively modulates transcripti
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 329 385 Homeodomain Domain
PF03826 OAR 526 544 OAR motif Motif
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in fetal and adult brain and skeletal muscle. Expression is specific to the telencephalon and ventral thalamus. There is an absence of expression in the cerebellum throughout development and also in adult. {ECO:
Sequence
MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADP
EKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAAATATAG
PRGEAPPPPPPTARPGERPDGAGAAAAAAAAAAAAWDTLKISQAPQVSISRSKSYRENGA
PFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEE
EELLEDDEEELLEDDARALLKEPRRCPVAATGAVAAAAAAAVATEGGELSPKEELLLHPE
DAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREE
LAMRLDLTEARVQVWFQNRRAKWRK
REKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFP
PHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPA
FGRLFSTMAPLTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAK
EHAA
QLTQLNILPGTSTGKEVC
Sequence length 562
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 1 rs932485786, rs387906715, rs869312662, rs886039308, rs1601946492, rs1601946502, rs387906492, rs1468724042, rs1365611175, rs587783191, rs104894743, rs1556054888, rs1556056125, rs398122854 N/A
Epileptic encephalopathy epileptic encephalopathy, early infanitle, 1 rs104894745, rs587783192, rs587783200 N/A
Mental retardation intellectual disability rs1601946481 N/A
Mental Retardation, X-Linked Intellectual disability, X-linked, with or without seizures, arx-related rs1328291159, rs28936077, rs1569395541, rs1569394026, rs398122854 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Infantile Spasms infantile spasms N/A N/A GenCC
Neurodevelopmental Disorders X-linked complex neurodevelopmental disorder N/A N/A GenCC
Partington Syndrome partington syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 19747203
Anxiety Associate 21426321
Apraxia Ideomotor Associate 24528893, 29984154
Apraxias Associate 24528893, 29984154
Atrophy Associate 19747203
Autistic Disorder Associate 17044103
Basal Ganglia Diseases Associate 29984154
Brain Diseases Associate 17044103, 19738637, 19747203, 21108397, 21426321, 26344814
Central Nervous System Diseases Associate 21426321
Central Nervous System Vascular Malformations Associate 20384723, 26306640