Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	169792
Gene name	GLIS family zinc finger 3
Gene symbol	GLIS3
Synonyms (NCBI Gene)	NDHZNF515
Chromosome	9
Chromosome location	9p24.2
Summary	This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear protein with five C2H2-type zinc finger domains. This protein functions as both a repressor and activator of transcription and is specifically involved in the develo

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114838275	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs148168366	G>A,C	Conflicting-interpretations-of-pathogenicity, likely-benign	5 prime UTR variant, intron variant, genic upstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs868197660	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs869320723	->G	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs879255608	G>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs879255609	C>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1586744173	->AG	Likely-pathogenic	Intron variant, non coding transcript variant, coding sequence variant, frameshift variant

232

Show/Hide all (232)

miRTarBase ID	miRNA	Experiments	Reference
MIRT657782	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657781	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657779	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT657780	hsa-miR-3655	HITS-CLIP	23824327
MIRT657778	hsa-miR-3909	HITS-CLIP	23824327
MIRT657777	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT657776	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT657775	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT657774	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657772	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT657773	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT657771	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT448804	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT448803	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT448802	hsa-miR-3609	PAR-CLIP	22100165
MIRT448801	hsa-miR-548ah-5p	PAR-CLIP	22100165
MIRT448800	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT448799	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT440564	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440564	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT733110	hsa-miR-644a	ImmunofluorescenceIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33520363
MIRT657782	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657781	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657779	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT657780	hsa-miR-3655	HITS-CLIP	23824327
MIRT657778	hsa-miR-3909	HITS-CLIP	23824327
MIRT657777	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT657776	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT657775	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT657774	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657772	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT657773	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT657771	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT448804	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT448803	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT448802	hsa-miR-3609	PAR-CLIP	22100165
MIRT448801	hsa-miR-548ah-5p	PAR-CLIP	22100165
MIRT448800	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT448799	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT1021179	hsa-miR-106a	CLIP-seq
MIRT1021180	hsa-miR-106b	CLIP-seq
MIRT1021181	hsa-miR-1245b-3p	CLIP-seq
MIRT1021182	hsa-miR-1273	CLIP-seq
MIRT1021183	hsa-miR-1286	CLIP-seq
MIRT1021184	hsa-miR-1304	CLIP-seq
MIRT1021185	hsa-miR-1324	CLIP-seq
MIRT1021186	hsa-miR-17	CLIP-seq
MIRT1021187	hsa-miR-2054	CLIP-seq
MIRT1021188	hsa-miR-20a	CLIP-seq
MIRT1021189	hsa-miR-20b	CLIP-seq
MIRT1021190	hsa-miR-302a	CLIP-seq
MIRT1021191	hsa-miR-302b	CLIP-seq
MIRT1021192	hsa-miR-302c	CLIP-seq
MIRT1021193	hsa-miR-302d	CLIP-seq
MIRT1021194	hsa-miR-302e	CLIP-seq
MIRT1021195	hsa-miR-3074-5p	CLIP-seq
MIRT1021196	hsa-miR-3173-3p	CLIP-seq
MIRT1021197	hsa-miR-361-3p	CLIP-seq
MIRT1021198	hsa-miR-3616-3p	CLIP-seq
MIRT1021199	hsa-miR-3677-5p	CLIP-seq
MIRT1021200	hsa-miR-3683	CLIP-seq
MIRT1021201	hsa-miR-370	CLIP-seq
MIRT1021202	hsa-miR-372	CLIP-seq
MIRT1021203	hsa-miR-373	CLIP-seq
MIRT1021204	hsa-miR-375	CLIP-seq
MIRT1021205	hsa-miR-380	CLIP-seq
MIRT1021206	hsa-miR-3915	CLIP-seq
MIRT1021207	hsa-miR-3924	CLIP-seq
MIRT1021208	hsa-miR-3926	CLIP-seq
MIRT1021209	hsa-miR-3928	CLIP-seq
MIRT1021210	hsa-miR-3944-5p	CLIP-seq
MIRT1021211	hsa-miR-4302	CLIP-seq
MIRT1021212	hsa-miR-431	CLIP-seq
MIRT1021213	hsa-miR-4433	CLIP-seq
MIRT1021214	hsa-miR-4436b-5p	CLIP-seq
MIRT1021215	hsa-miR-4446-3p	CLIP-seq
MIRT1021216	hsa-miR-4446-5p	CLIP-seq
MIRT1021217	hsa-miR-4455	CLIP-seq
MIRT1021218	hsa-miR-4475	CLIP-seq
MIRT1021219	hsa-miR-4476	CLIP-seq
MIRT1021220	hsa-miR-4495	CLIP-seq
MIRT1021221	hsa-miR-4533	CLIP-seq
MIRT1021222	hsa-miR-4653-3p	CLIP-seq
MIRT1021223	hsa-miR-4663	CLIP-seq
MIRT1021224	hsa-miR-4699-5p	CLIP-seq
MIRT1021225	hsa-miR-4709-3p	CLIP-seq
MIRT1021226	hsa-miR-4721	CLIP-seq
MIRT1021227	hsa-miR-4722-5p	CLIP-seq
MIRT1021228	hsa-miR-4779	CLIP-seq
MIRT1021229	hsa-miR-508-3p	CLIP-seq
MIRT1021230	hsa-miR-511	CLIP-seq
MIRT1021231	hsa-miR-519d	CLIP-seq
MIRT1021232	hsa-miR-520a-3p	CLIP-seq
MIRT1021233	hsa-miR-520b	CLIP-seq
MIRT1021234	hsa-miR-520c-3p	CLIP-seq
MIRT1021235	hsa-miR-520d-3p	CLIP-seq
MIRT1021236	hsa-miR-520e	CLIP-seq
MIRT1021237	hsa-miR-520f	CLIP-seq
MIRT1021238	hsa-miR-520g	CLIP-seq
MIRT1021239	hsa-miR-520h	CLIP-seq
MIRT1021240	hsa-miR-548a-5p	CLIP-seq
MIRT1021241	hsa-miR-548ab	CLIP-seq
MIRT1021242	hsa-miR-548ak	CLIP-seq
MIRT1021243	hsa-miR-548b-5p	CLIP-seq
MIRT1021244	hsa-miR-548c-5p	CLIP-seq
MIRT1021245	hsa-miR-548d-5p	CLIP-seq
MIRT1021246	hsa-miR-548h	CLIP-seq
MIRT1021247	hsa-miR-548i	CLIP-seq
MIRT1021248	hsa-miR-548j	CLIP-seq
MIRT1021249	hsa-miR-548s	CLIP-seq
MIRT1021250	hsa-miR-548w	CLIP-seq
MIRT1021251	hsa-miR-548y	CLIP-seq
MIRT1021252	hsa-miR-555	CLIP-seq
MIRT1021253	hsa-miR-559	CLIP-seq
MIRT1021254	hsa-miR-653	CLIP-seq
MIRT1021255	hsa-miR-93	CLIP-seq
MIRT1021256	hsa-miR-1238	CLIP-seq
MIRT1021181	hsa-miR-1245b-3p	CLIP-seq
MIRT1021182	hsa-miR-1273	CLIP-seq
MIRT1021184	hsa-miR-1304	CLIP-seq
MIRT1021185	hsa-miR-1324	CLIP-seq
MIRT1021257	hsa-miR-181a	CLIP-seq
MIRT1021258	hsa-miR-181b	CLIP-seq
MIRT1021259	hsa-miR-181c	CLIP-seq
MIRT1021260	hsa-miR-181d	CLIP-seq
MIRT1021195	hsa-miR-3074-5p	CLIP-seq
MIRT1021261	hsa-miR-3163	CLIP-seq
MIRT1021196	hsa-miR-3173-3p	CLIP-seq
MIRT1021198	hsa-miR-3616-3p	CLIP-seq
MIRT1021262	hsa-miR-3671	CLIP-seq
MIRT1021200	hsa-miR-3683	CLIP-seq
MIRT1021201	hsa-miR-370	CLIP-seq
MIRT1021205	hsa-miR-380	CLIP-seq
MIRT1021206	hsa-miR-3915	CLIP-seq
MIRT1021207	hsa-miR-3924	CLIP-seq
MIRT1021209	hsa-miR-3928	CLIP-seq
MIRT1021263	hsa-miR-4262	CLIP-seq
MIRT1021219	hsa-miR-4476	CLIP-seq
MIRT1021220	hsa-miR-4495	CLIP-seq
MIRT1021221	hsa-miR-4533	CLIP-seq
MIRT1021222	hsa-miR-4653-3p	CLIP-seq
MIRT1021223	hsa-miR-4663	CLIP-seq
MIRT1021264	hsa-miR-4691-5p	CLIP-seq
MIRT1021265	hsa-miR-4720-5p	CLIP-seq
MIRT1021226	hsa-miR-4721	CLIP-seq
MIRT1021266	hsa-miR-4769-3p	CLIP-seq
MIRT1021228	hsa-miR-4779	CLIP-seq
MIRT1021267	hsa-miR-4799-3p	CLIP-seq
MIRT1021268	hsa-miR-548aa	CLIP-seq
MIRT1021252	hsa-miR-555	CLIP-seq
MIRT1021269	hsa-miR-579	CLIP-seq
MIRT1021270	hsa-miR-664	CLIP-seq
MIRT2002576	hsa-miR-1267	CLIP-seq
MIRT2002577	hsa-miR-129-5p	CLIP-seq
MIRT1021190	hsa-miR-302a	CLIP-seq
MIRT1021191	hsa-miR-302b	CLIP-seq
MIRT1021192	hsa-miR-302c	CLIP-seq
MIRT1021193	hsa-miR-302d	CLIP-seq
MIRT1021194	hsa-miR-302e	CLIP-seq
MIRT1021195	hsa-miR-3074-5p	CLIP-seq
MIRT1021196	hsa-miR-3173-3p	CLIP-seq
MIRT1021201	hsa-miR-370	CLIP-seq
MIRT1021202	hsa-miR-372	CLIP-seq
MIRT1021203	hsa-miR-373	CLIP-seq
MIRT1021206	hsa-miR-3915	CLIP-seq
MIRT1021209	hsa-miR-3928	CLIP-seq
MIRT2002578	hsa-miR-3977	CLIP-seq
MIRT1021215	hsa-miR-4446-3p	CLIP-seq
MIRT1021219	hsa-miR-4476	CLIP-seq
MIRT2002579	hsa-miR-4506	CLIP-seq
MIRT1021221	hsa-miR-4533	CLIP-seq
MIRT1021223	hsa-miR-4663	CLIP-seq
MIRT1021226	hsa-miR-4721	CLIP-seq
MIRT1021228	hsa-miR-4779	CLIP-seq
MIRT1021232	hsa-miR-520a-3p	CLIP-seq
MIRT1021233	hsa-miR-520b	CLIP-seq
MIRT1021234	hsa-miR-520c-3p	CLIP-seq
MIRT1021235	hsa-miR-520d-3p	CLIP-seq
MIRT1021236	hsa-miR-520e	CLIP-seq
MIRT1021237	hsa-miR-520f	CLIP-seq
MIRT2235566	hsa-miR-3199	CLIP-seq
MIRT2235567	hsa-miR-4318	CLIP-seq
MIRT1021214	hsa-miR-4436b-5p	CLIP-seq
MIRT2235568	hsa-miR-4463	CLIP-seq
MIRT1021190	hsa-miR-302a	CLIP-seq
MIRT1021191	hsa-miR-302b	CLIP-seq
MIRT1021192	hsa-miR-302c	CLIP-seq
MIRT1021193	hsa-miR-302d	CLIP-seq
MIRT1021194	hsa-miR-302e	CLIP-seq
MIRT1021195	hsa-miR-3074-5p	CLIP-seq
MIRT2388501	hsa-miR-3145-3p	CLIP-seq
MIRT1021196	hsa-miR-3173-3p	CLIP-seq
MIRT2388502	hsa-miR-323b-3p	CLIP-seq
MIRT1021201	hsa-miR-370	CLIP-seq
MIRT1021202	hsa-miR-372	CLIP-seq
MIRT1021203	hsa-miR-373	CLIP-seq
MIRT1021206	hsa-miR-3915	CLIP-seq
MIRT1021209	hsa-miR-3928	CLIP-seq
MIRT1021219	hsa-miR-4476	CLIP-seq
MIRT1021221	hsa-miR-4533	CLIP-seq
MIRT1021223	hsa-miR-4663	CLIP-seq
MIRT2388503	hsa-miR-4768-5p	CLIP-seq
MIRT1021228	hsa-miR-4779	CLIP-seq
MIRT1021232	hsa-miR-520a-3p	CLIP-seq
MIRT1021233	hsa-miR-520b	CLIP-seq
MIRT1021234	hsa-miR-520c-3p	CLIP-seq
MIRT1021235	hsa-miR-520d-3p	CLIP-seq
MIRT1021236	hsa-miR-520e	CLIP-seq
MIRT2539431	hsa-miR-29a	CLIP-seq
MIRT2539432	hsa-miR-29b	CLIP-seq
MIRT2539433	hsa-miR-29c	CLIP-seq
MIRT2539434	hsa-miR-3148	CLIP-seq
MIRT2539435	hsa-miR-3189-5p	CLIP-seq
MIRT2539436	hsa-miR-3659	CLIP-seq
MIRT2539437	hsa-miR-3688-3p	CLIP-seq
MIRT2539438	hsa-miR-455-5p	CLIP-seq
MIRT2539439	hsa-miR-4658	CLIP-seq
MIRT2539440	hsa-miR-4668-3p	CLIP-seq
MIRT2539441	hsa-miR-4684-5p	CLIP-seq
MIRT2539442	hsa-miR-4712-5p	CLIP-seq
MIRT2388503	hsa-miR-4768-5p	CLIP-seq
MIRT2539443	hsa-miR-518d-5p	CLIP-seq
MIRT2539444	hsa-miR-519b-5p	CLIP-seq
MIRT2539445	hsa-miR-519c-5p	CLIP-seq
MIRT2539446	hsa-miR-520c-5p	CLIP-seq
MIRT2539447	hsa-miR-526a	CLIP-seq
MIRT2539448	hsa-miR-550a	CLIP-seq
MIRT2539449	hsa-miR-570	CLIP-seq
MIRT2539450	hsa-miR-574-5p	CLIP-seq
MIRT2539451	hsa-miR-576-3p	CLIP-seq
MIRT1021269	hsa-miR-579	CLIP-seq
MIRT2539452	hsa-miR-770-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	14500813, 18263616
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	14500813
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	14500813, 18263616
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 20211142, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	14500813, 18263616
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
610192	28510	ENSG00000107249

Q8NEA6

Protein name

Zinc finger protein GLIS3 (GLI-similar 3) (Zinc finger protein 515)

Protein function

Acts both as a repressor and an activator of transcription. Binds to the consensus sequence 5'-GACCACCCAC-3' (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	413 → 436	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	472 → 496	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: In the adult, expressed at high levels in the kidney and at lower levels in the brain, skeletal muscle, pancreas, liver, lung, thymus and ovary. {ECO:0000269|PubMed:14500813}.

Sequence

MMVQRLGLISPPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLT
ESQSASSMKQEWSQGYRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFG
TESSHSPYPSPRHSSTRSHSARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSR
ASPANLSPQPEVYGHFLGVRGSCIPQPRPVPGSQKGVLVAPGGLALPAYGEDGALEHERM
QQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTERLEEFPGSTVDLPPAPPLPPLPPP
PGPPPPYHAHAHLHHPELGPHAQQLALPQATLDDDGEMDGIGGKHCCRWIDCSALYDQQE
ELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCE
KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCT
KRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEG
TVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLP
PLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSS
FQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFH
RAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG

Sequence length

775

Interactions

View interactions

428

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
GLIS3-related disorder	Likely pathogenic	rs765684343	RCV003894070
Neonatal diabetes mellitus with congenital hypothyroidism	Pathogenic; Likely pathogenic	rs869320723, rs879255608, rs868197660, rs879255609, rs773807925, rs765684343, rs1586744173	RCV000001388 RCV000239543 RCV000239596 RCV000239491 RCV003228657 RCV005051417 RCV000826113

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs80030970	RCV005900570
Congenital aniridia	Conflicting classifications of pathogenicity	rs150310830	RCV005419889
Congenital hypothyroidism	Uncertain significance	rs752946704	RCV006444046
Diabetes mellitus	Benign	rs148199056, rs6415788	RCV002226664 RCV002226665
Malignant lymphoma, large B-cell, diffuse	Benign	rs676935	RCV005921477
Monogenic diabetes	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs76094493, rs35154632, rs148199056, rs143056249, rs76342955, rs143051164, rs148572278, rs1057524895, rs145867412, rs755318788, rs80161424, rs138497710, rs146131512, rs761151597, rs148168366 View all (14 more)	RCV000445419 RCV000664126 RCV001174470 RCV001174472 RCV000445363 RCV000445503 RCV000664125 RCV000445541 RCV000445462 RCV000445531 RCV000445415 RCV000445483 RCV000445431 RCV000445380 RCV000445451 RCV001174468 RCV000664121 RCV000664122 RCV000664123 RCV000664124 RCV001174473 RCV001174469 RCV001174443 RCV001174471 RCV001174474 RCV001174475 RCV001174476 RCV001174477 RCV001174478
Sarcoma	Benign	rs664334	RCV005921465
Transitory neonatal diabetes mellitus	Benign; Likely benign; Conflicting classifications of pathogenicity	rs74680081, rs529418802, rs117802495, rs75462592, rs75564360, rs141985853, rs377419083, rs76342955, rs80161424, rs146131512, rs374943049	RCV002465959 RCV002465960 RCV002465605 RCV002465643 RCV002465645 RCV002465641 RCV002465642 RCV002465644 RCV002465652 RCV002465653 RCV002465809
Uterine corpus endometrial carcinoma	Benign	rs1331260	RCV005900571

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	30648929, 31273314
Anemia	Associate	33935973
Anorchia	Associate	28253873
Body Dysmorphic Disorders	Associate	28253873
Bone Diseases Metabolic	Associate	28253873
Chemical and Drug Induced Liver Injury	Associate	26259131
Choanal Atresia	Associate	26259131, 28253873
Cholestasis	Associate	33935973
Cone Rod Dystrophies	Associate	16909397
Congenital Hypothyroidism	Associate	27148679, 28253873, 33935973, 34093443, 34200080
Craniosynostoses	Associate	26259131, 28253873
Cryptorchidism	Associate	28253873
Cysts	Associate	26259131
Developmental Disabilities	Associate	34093443
Diabetes Gestational	Associate	29947923, 36313769
Diabetes Mellitus	Associate	22662265, 26839896, 28253873, 28520980, 29246973, 29436472, 31415576, 33376132, 34093443, 35246208, 37897565
Diabetes Mellitus Neonatal with Congenital Hypothyroidism	Associate	33935973
Diabetes Mellitus Transient Neonatal 1	Associate	26259131, 27148679, 28253873, 33935973, 37897565
Diabetes Mellitus Type 1	Associate	19430480, 26053495, 28520980, 31455420, 31558544
Diabetes Mellitus Type 2	Associate	21103350, 21747906, 21949744, 22662265, 22961080, 24086726, 24953961, 26053495, 29606121, 31123324, 31145772, 31415576, 33830302, 35246208
Ear Diseases	Associate	27148679
Exocrine Pancreatic Insufficiency	Associate	26259131, 28253873, 33935973
Facial Dysmorphism with Multiple Malformations	Associate	27148679, 28253873
Fibrosis	Associate	26259131
Glaucoma	Associate	27148679
Glaucoma 3 Primary Congenital A	Associate	28253873, 34093443
Glaucoma Angle Closure	Associate	30399154
Glioblastoma	Associate	36114444
Glioma	Associate	20838435
Hearing Loss Sensorineural	Associate	26259131, 28253873
Heart Septal Defects Atrial	Associate	26259131
Hernia Hiatal	Associate	26259131
Hypoglycemia	Associate	21747906
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	27148679
Hypospadias	Associate	28253873
Hypothyroidism Congenital Nongoitrous 1	Associate	33935973
Islet cell tumor syndrome	Associate	31123324
Kidney Diseases	Associate	26259131, 27148679
Kidney Diseases Cystic	Associate	34093443
Liver Cirrhosis	Associate	28253873
Liver Diseases	Associate	28253873
Liver Failure	Associate	26259131
Mason Type Diabetes	Associate	29606121
Megalocornea	Associate	33935973
Metabolic Syndrome	Associate	37816730
Myocardial Bridging	Associate	27148679
Neoplasms	Associate	25122662, 34282807
Neoplasms	Stimulate	36724950
Obesity	Stimulate	35246208
Osteoarthritis	Associate	29436472
Polycystic Kidney Diseases	Associate	28253873
Post Acute COVID 19 Syndrome	Associate	27148679
Renal dysplasia diffuse cystic	Associate	26259131
Skin Manifestations	Associate	26259131
Thyroid Diseases	Associate	26259131
Thyroid Neoplasms	Associate	34282807
Triple Negative Breast Neoplasms	Associate	36724950

GLIS3 (GLIS family zinc finger 3)