Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	169026
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 30 member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC30A8
Synonyms (NCBI Gene) Gene synonyms aliases	ZNT8, ZnT-8
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalize

Show/Hide all(175)

miRTarBase ID	miRNA	Experiments
MIRT1359590	hsa-miR-140-3p	CLIP-seq
MIRT1359591	hsa-miR-146b-3p	CLIP-seq
MIRT1359592	hsa-miR-3157-3p	CLIP-seq
MIRT1359593	hsa-miR-3173-5p	CLIP-seq
MIRT1359594	hsa-miR-320a	CLIP-seq
MIRT1359595	hsa-miR-320b	CLIP-seq
MIRT1359596	hsa-miR-320c	CLIP-seq
MIRT1359597	hsa-miR-320d	CLIP-seq
MIRT1359598	hsa-miR-4429	CLIP-seq
MIRT1359599	hsa-miR-4453	CLIP-seq
MIRT1359600	hsa-miR-4514	CLIP-seq
MIRT1359601	hsa-miR-4538	CLIP-seq
MIRT1359602	hsa-miR-4645-5p	CLIP-seq
MIRT1359603	hsa-miR-4673	CLIP-seq
MIRT1359604	hsa-miR-4679	CLIP-seq
MIRT1359605	hsa-miR-4692	CLIP-seq
MIRT1359606	hsa-miR-4755-3p	CLIP-seq
MIRT1359607	hsa-miR-514	CLIP-seq
MIRT1359608	hsa-miR-514b-3p	CLIP-seq
MIRT1359609	hsa-miR-640	CLIP-seq
MIRT1359610	hsa-miR-874	CLIP-seq
MIRT1359611	hsa-miR-940	CLIP-seq
MIRT1359612	hsa-miR-103a	CLIP-seq
MIRT1359613	hsa-miR-107	CLIP-seq
MIRT1359614	hsa-miR-10a	CLIP-seq
MIRT1359615	hsa-miR-10b	CLIP-seq
MIRT1359616	hsa-miR-1302	CLIP-seq
MIRT1359617	hsa-miR-183	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT1359619	hsa-miR-25	CLIP-seq
MIRT1359620	hsa-miR-3127-5p	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT1359622	hsa-miR-3163	CLIP-seq
MIRT1359623	hsa-miR-32	CLIP-seq
MIRT1359624	hsa-miR-33a	CLIP-seq
MIRT1359625	hsa-miR-33b	CLIP-seq
MIRT1359626	hsa-miR-363	CLIP-seq
MIRT1359627	hsa-miR-3662	CLIP-seq
MIRT1359628	hsa-miR-367	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT1359630	hsa-miR-3944-5p	CLIP-seq
MIRT1359631	hsa-miR-4261	CLIP-seq
MIRT1359632	hsa-miR-4270	CLIP-seq
MIRT1359633	hsa-miR-4292	CLIP-seq
MIRT1359634	hsa-miR-4298	CLIP-seq
MIRT1359635	hsa-miR-4441	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT1359637	hsa-miR-4735-5p	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT1359639	hsa-miR-545	CLIP-seq
MIRT1359640	hsa-miR-548a-5p	CLIP-seq
MIRT1359641	hsa-miR-548ab	CLIP-seq
MIRT1359642	hsa-miR-548ak	CLIP-seq
MIRT1359643	hsa-miR-548b-5p	CLIP-seq
MIRT1359644	hsa-miR-548c-5p	CLIP-seq
MIRT1359645	hsa-miR-548d-5p	CLIP-seq
MIRT1359646	hsa-miR-548h	CLIP-seq
MIRT1359647	hsa-miR-548i	CLIP-seq
MIRT1359648	hsa-miR-548j	CLIP-seq
MIRT1359649	hsa-miR-548k	CLIP-seq
MIRT1359650	hsa-miR-548l	CLIP-seq
MIRT1359651	hsa-miR-548w	CLIP-seq
MIRT1359652	hsa-miR-548y	CLIP-seq
MIRT1359653	hsa-miR-559	CLIP-seq
MIRT1359654	hsa-miR-595	CLIP-seq
MIRT1359655	hsa-miR-676	CLIP-seq
MIRT1359656	hsa-miR-767-5p	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq
MIRT1359658	hsa-miR-92a	CLIP-seq
MIRT1359659	hsa-miR-92b	CLIP-seq
MIRT2106430	hsa-miR-1272	CLIP-seq
MIRT2106431	hsa-miR-1273f	CLIP-seq
MIRT2106432	hsa-miR-1322	CLIP-seq
MIRT2106433	hsa-miR-143	CLIP-seq
MIRT1359617	hsa-miR-183	CLIP-seq
MIRT2106434	hsa-miR-186	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT2106435	hsa-miR-205	CLIP-seq
MIRT2106436	hsa-miR-2117	CLIP-seq
MIRT2106437	hsa-miR-2467-3p	CLIP-seq
MIRT2106438	hsa-miR-298	CLIP-seq
MIRT2106439	hsa-miR-3133	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT2106440	hsa-miR-3613-3p	CLIP-seq
MIRT2106441	hsa-miR-3678-3p	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT2106442	hsa-miR-3907	CLIP-seq
MIRT2106443	hsa-miR-4272	CLIP-seq
MIRT2106444	hsa-miR-4273	CLIP-seq
MIRT2106445	hsa-miR-4276	CLIP-seq
MIRT2106446	hsa-miR-4282	CLIP-seq
MIRT2106447	hsa-miR-431	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT2106448	hsa-miR-4666-5p	CLIP-seq
MIRT2106449	hsa-miR-4738-3p	CLIP-seq
MIRT2106450	hsa-miR-4756-3p	CLIP-seq
MIRT2106451	hsa-miR-4770	CLIP-seq
MIRT2106452	hsa-miR-4776-3p	CLIP-seq
MIRT2106453	hsa-miR-4778-3p	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT2106454	hsa-miR-513c	CLIP-seq
MIRT2106455	hsa-miR-514b-5p	CLIP-seq
MIRT1359640	hsa-miR-548a-5p	CLIP-seq
MIRT1359641	hsa-miR-548ab	CLIP-seq
MIRT1359642	hsa-miR-548ak	CLIP-seq
MIRT1359643	hsa-miR-548b-5p	CLIP-seq
MIRT1359644	hsa-miR-548c-5p	CLIP-seq
MIRT1359645	hsa-miR-548d-5p	CLIP-seq
MIRT1359646	hsa-miR-548h	CLIP-seq
MIRT1359647	hsa-miR-548i	CLIP-seq
MIRT1359648	hsa-miR-548j	CLIP-seq
MIRT1359649	hsa-miR-548k	CLIP-seq
MIRT1359650	hsa-miR-548l	CLIP-seq
MIRT1359651	hsa-miR-548w	CLIP-seq
MIRT1359652	hsa-miR-548y	CLIP-seq
MIRT1359653	hsa-miR-559	CLIP-seq
MIRT2106456	hsa-miR-586	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq
MIRT1359612	hsa-miR-103a	CLIP-seq
MIRT1359613	hsa-miR-107	CLIP-seq
MIRT2330731	hsa-miR-1236	CLIP-seq
MIRT1359617	hsa-miR-183	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT2330732	hsa-miR-3919	CLIP-seq
MIRT1359630	hsa-miR-3944-5p	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT2330733	hsa-miR-4753-3p	CLIP-seq
MIRT2106452	hsa-miR-4776-3p	CLIP-seq
MIRT2106453	hsa-miR-4778-3p	CLIP-seq
MIRT2330734	hsa-miR-4797-5p	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT2330735	hsa-miR-499-3p	CLIP-seq
MIRT2330736	hsa-miR-499a-3p	CLIP-seq
MIRT2330737	hsa-miR-541	CLIP-seq
MIRT1359639	hsa-miR-545	CLIP-seq
MIRT2330738	hsa-miR-615-5p	CLIP-seq
MIRT2330739	hsa-miR-654-5p	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq
MIRT2330740	hsa-miR-942	CLIP-seq
MIRT2106436	hsa-miR-2117	CLIP-seq
MIRT2106444	hsa-miR-4273	CLIP-seq
MIRT2106454	hsa-miR-513c	CLIP-seq
MIRT2106455	hsa-miR-514b-5p	CLIP-seq
MIRT2106456	hsa-miR-586	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq
MIRT1359612	hsa-miR-103a	CLIP-seq
MIRT1359613	hsa-miR-107	CLIP-seq
MIRT1359617	hsa-miR-183	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT1359630	hsa-miR-3944-5p	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT2106448	hsa-miR-4666-5p	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT1359639	hsa-miR-545	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq
MIRT1359612	hsa-miR-103a	CLIP-seq
MIRT1359613	hsa-miR-107	CLIP-seq
MIRT1359617	hsa-miR-183	CLIP-seq
MIRT1359618	hsa-miR-194	CLIP-seq
MIRT1359621	hsa-miR-3144-3p	CLIP-seq
MIRT1359629	hsa-miR-380	CLIP-seq
MIRT1359630	hsa-miR-3944-5p	CLIP-seq
MIRT1359636	hsa-miR-4495	CLIP-seq
MIRT1359638	hsa-miR-495	CLIP-seq
MIRT1359639	hsa-miR-545	CLIP-seq
MIRT1359657	hsa-miR-875-5p	CLIP-seq

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IDA	15331542
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	24955142, 25416956, 25910212, 32296183
GO:0005794	Component	Golgi apparatus	IDA	15331542
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15331542
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006829	Process	Zinc ion transport	IDA	15331542
GO:0006829	Process	Zinc ion transport	IEA
GO:0006882	Process	Intracellular zinc ion homeostasis	IEA
GO:0006882	Process	Intracellular zinc ion homeostasis	ISS
GO:0008270	Function	Zinc ion binding	IC	15331542
GO:0008324	Function	Monoatomic cation transmembrane transporter activity	IEA
GO:0009749	Process	Response to glucose	IBA
GO:0009749	Process	Response to glucose	IEA
GO:0009749	Process	Response to glucose	IMP	16984975
GO:0010043	Process	Response to zinc ion	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030070	Process	Insulin processing	IEA
GO:0030070	Process	Insulin processing	TAS
GO:0030073	Process	Insulin secretion	IBA
GO:0030073	Process	Insulin secretion	IEA
GO:0030073	Process	Insulin secretion	IMP	16984975
GO:0030141	Component	Secretory granule	IDA	15331542
GO:0030141	Component	Secretory granule	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IDA	16984975
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0034341	Process	Response to type II interferon	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060627	Process	Regulation of vesicle-mediated transport	IEA
GO:0060627	Process	Regulation of vesicle-mediated transport	ISS
GO:0062111	Process	Zinc ion import into organelle	IEA
GO:0062111	Process	Zinc ion import into organelle	IMP	16984975
GO:0070555	Process	Response to interleukin-1	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	TAS
GO:0071578	Process	Zinc ion import across plasma membrane	IEA
GO:0071578	Process	Zinc ion import across plasma membrane	ISS
GO:0140826	Function	Zinc:proton antiporter activity	IDA	32723473

MIM	HGNC	e!Ensembl
611145	20303	ENSG00000164756

Protein

UniProt ID

Q8IWU4

Protein name

Proton-coupled zinc antiporter SLC30A8 (Solute carrier family 30 member 8) (Zinc transporter 8) (ZnT-8)

Protein function

Proton-coupled zinc ion antiporter mediating the entry of zinc into the lumen of pancreatic beta cell secretory granules, thereby regulating insulin secretion. {ECO:0000269|PubMed:15331542, ECO:0000269|PubMed:16984975, ECO:0000269|PubMed:2787531

PDB

6XPD , 6XPE , 6XPF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01545	Cation_efflux	74 → 275	Cation efflux family	Family

Tissue specificity

TISSUE SPECIFICITY: In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in s

Sequence

MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPT
EKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFS
LWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMII
VSSCAVAANIVLTVVLHQRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYF
KPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSV
HSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPD
CLFCEDPCD

Sequence length

369

Interactions

View interactions

	Reactome
			Insulin processing Zinc efflux and compartmentalization by the SLC30 family

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Diabetes	Type ii diabetes, Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes with renal manifestations (PheCode 250.22), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Type 2 diabetes, Diabetes, Youth-onset type 2 diabetes, Chronic kidney disease and diabetic kidney disease in type 2 diabetes, Type 2 diabetes (adjusted for BMI)	N/A	N/A	GWAS
Diabetes Mellitus	Diabetes mellitus type 2, susceptibility to, Type 2 diabetes mellitus	N/A	N/A	ClinVar
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Addison Disease	Associate	26972575
Adenocarcinoma of Lung	Associate	28181565
Adenoma Islet Cell	Stimulate	32686271, 37043275
Aortic Aneurysm Abdominal	Inhibit	24423473
Aortic Aneurysm Abdominal	Associate	24423473
Autoimmune Diseases	Associate	26972575
Breast Neoplasms	Associate	23884293, 30457165
Colorectal Neoplasms	Associate	37365285
Cystic Fibrosis	Associate	23535193
Diabetes Gestational	Associate	27600066, 28363002, 29947923, 34928995
Diabetes Gestational	Inhibit	28072873
Diabetes Mellitus	Associate	17463249, 18544707, 19008344, 20929593, 21708156, 21779873, 22446173, 22787139, 23061550, 23194113, 24332797, 24471563, 25348609, 28352089, 28363002 View all (7 more)
Diabetes Mellitus Congenital Autoimmune	Associate	37600804
Diabetes Mellitus Type 1	Associate	17942684, 18591387, 20610599, 20836749, 21067978, 21244337, 21471440, 21604969, 21708156, 21875382, 22446173, 22526605, 22787139, 23061550, 23194113 View all (19 more)
Diabetes Mellitus Type 2	Associate	17463248, 17463249, 17786204, 18426861, 18461161, 18469204, 18498634, 18591387, 18633108, 18694974, 19008344, 19020324, 19033397, 19056611, 19228808 View all (46 more)
Hashimoto Disease	Associate	24830306
Hypoglycemia	Associate	18633108
Inflammation	Associate	31591269
Insulin Resistance	Associate	32996898, 33508935
Insulinoma	Associate	17786204, 31591269, 34130115
Latent Autoimmune Diabetes in Adults	Associate	21875382, 23061550, 23194113, 36401613
Metabolic Syndrome	Associate	28490771, 37816730
Neoplasms	Associate	23884293
Obesity	Associate	18469204, 18498634, 25060389, 36827808
Obesity Abdominal	Associate	28490771
Thyroid Diseases	Associate	32896170
Weight Gain	Associate	27600066

SLC30A8 (solute carrier family 30 member 8)