Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
167691
Gene name Gene Name - the full gene name approved by the HGNC.
Lebercilin LCA5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LCA5
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf152
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Alternatively spliced transcript variants are described. [provided by RefSeq, Oct 2009]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918165 G>A Pathogenic Stop gained, coding sequence variant
rs183261547 G>A,C Pathogenic Coding sequence variant, stop gained, synonymous variant
rs746351112 C>A,T Likely-pathogenic Splice donor variant
rs781035395 G>A Pathogenic Stop gained, coding sequence variant
rs786205653 C>- Likely-pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019013 hsa-miR-335-5p Microarray 18185580
MIRT019478 hsa-miR-148b-3p Microarray 17612493
MIRT021827 hsa-miR-132-3p Microarray 17612493
MIRT023341 hsa-miR-122-5p Microarray 17612493
MIRT025623 hsa-miR-10a-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19800048, 22940612, 25416956, 26638075, 27173435, 28514442, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611408 31923 ENSG00000135338
Protein
UniProt ID Q86VQ0
Protein name Lebercilin (Leber congenital amaurosis 5 protein)
Protein function Involved in intraflagellar protein (IFT) transport in photoreceptor cilia.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15619 Lebercilin 100 292 Ciliary protein causing Leber congenital amaurosis disease Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:17546029}.
Sequence
MGERAGSPGTDQERKAGKHHYSYLSDFETPQSSGRSSLVSSSPASVRRKNPKRQTSDGQV
HHQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVS
ELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQE
KERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIK
ELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKEREL
DIKNIYSN
RLPKSSPNKEKELALRKNAACQSDFADLCTKGVQTMEDFKPEEYPLTPETIMCYENKWEE
PGHLTLDLQSQKQDRHGEAGILNPIMEREEKFVTDEELHVVKQEVEKLEDEWEREELDKK
QKEKASLLEREEKPEWETGRYQLGMYPIQNMDKLQGEEEERLKREMLLAKLNEIDRELQD
SRNLKYPVLPLLPDFESKLHSPERSPKTYRFSESSERLFNGHHLQDISFSTPKGEGQNSG
NVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEK
KANLMEQLFGASGSSTISSKSSDPNSVASSKGDIDPLNFLPGNKGSRDQEHDEDEGFFLS
EGRSFNPNRHRLKHADDKPAVKAADSVEDEIEEVALR
Sequence length 697
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Leber Congenital Amaurosis leber congenital amaurosis 5, Leber congenital amaurosis 1, leber congenital amaurosis rs183261547, rs1178243254, rs1057519136, rs1248460033, rs766143193, rs1182277140, rs386834252, rs1769845495, rs866395428, rs765473119, rs386834253, rs1268307330, rs1286660951, rs121918165, rs781035395
View all (4 more)
N/A
retinal dystrophy Retinal dystrophy rs748370008, rs1769692830, rs866395428, rs1769707298, rs386834252, rs121918165, rs746351112, rs878853382 N/A
Retinitis Pigmentosa retinitis pigmentosa rs1286660951 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amaurosis congenita of Leber type 5 Associate 27067258
Atrophy Associate 12642313
Cataract Associate 21850168
Colorectal Neoplasms Associate 30537927
Cone Dystrophy Associate 27067258
Death Associate 18334959
Eye Abnormalities Associate 12642313
Hereditary macular coloboma Associate 12642313
Hyperopia Associate 19503738
Leber Congenital Amaurosis Associate 12642313, 18334959, 18936139, 19503738, 21602930, 21850168, 23946133, 36369640, 39728598