Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1675
Gene name Gene Name - the full gene name approved by the HGNC.	Complement factor D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CFD
Synonyms (NCBI Gene) Gene synonyms aliases	ADIPSIN, ADN, DF, PFD
Disease Acronyms (UniProt) Disease acronyms from UniProt database	PFD
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the S1, or chymotrypsin, family of serine peptidases. This protease catalyzes the cleavage of factor B, the rate-limiting step of the alternative pathway of complement activation. This protein also functions as an adipokine,

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894667	C>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, stop gained
rs267606720	T>G	Pathogenic	Missense variant, coding sequence variant
rs267606721	T>C	Pathogenic	Missense variant, coding sequence variant
rs1021715434	G>C	Likely-pathogenic	Splice acceptor variant

Show/Hide all(87)

miRTarBase ID	miRNA	Experiments
MIRT887349	hsa-miR-1184	CLIP-seq
MIRT887350	hsa-miR-1539	CLIP-seq
MIRT887351	hsa-miR-1976	CLIP-seq
MIRT887352	hsa-miR-3135b	CLIP-seq
MIRT887353	hsa-miR-3193	CLIP-seq
MIRT887354	hsa-miR-34a	CLIP-seq
MIRT887355	hsa-miR-34c-5p	CLIP-seq
MIRT887356	hsa-miR-3616-3p	CLIP-seq
MIRT887357	hsa-miR-3652	CLIP-seq
MIRT887358	hsa-miR-3680	CLIP-seq
MIRT887359	hsa-miR-4418	CLIP-seq
MIRT887360	hsa-miR-4423-5p	CLIP-seq
MIRT887361	hsa-miR-4430	CLIP-seq
MIRT887362	hsa-miR-4436b-3p	CLIP-seq
MIRT887363	hsa-miR-449a	CLIP-seq
MIRT887364	hsa-miR-449b	CLIP-seq
MIRT887365	hsa-miR-4705	CLIP-seq
MIRT887366	hsa-miR-509-3-5p	CLIP-seq
MIRT887367	hsa-miR-509-5p	CLIP-seq
MIRT1921560	hsa-miR-1224-3p	CLIP-seq
MIRT1921561	hsa-miR-1234	CLIP-seq
MIRT1921562	hsa-miR-1237	CLIP-seq
MIRT1921563	hsa-miR-3127-3p	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT1921565	hsa-miR-544	CLIP-seq
MIRT1921560	hsa-miR-1224-3p	CLIP-seq
MIRT1921561	hsa-miR-1234	CLIP-seq
MIRT1921562	hsa-miR-1237	CLIP-seq
MIRT1921563	hsa-miR-3127-3p	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT1921565	hsa-miR-544	CLIP-seq
MIRT887352	hsa-miR-3135b	CLIP-seq
MIRT887354	hsa-miR-34a	CLIP-seq
MIRT887355	hsa-miR-34c-5p	CLIP-seq
MIRT887356	hsa-miR-3616-3p	CLIP-seq
MIRT887357	hsa-miR-3652	CLIP-seq
MIRT1963204	hsa-miR-3907	CLIP-seq
MIRT887361	hsa-miR-4430	CLIP-seq
MIRT887362	hsa-miR-4436b-3p	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT887363	hsa-miR-449a	CLIP-seq
MIRT887364	hsa-miR-449b	CLIP-seq
MIRT887365	hsa-miR-4705	CLIP-seq
MIRT1963205	hsa-miR-548u	CLIP-seq
MIRT887349	hsa-miR-1184	CLIP-seq
MIRT887352	hsa-miR-3135b	CLIP-seq
MIRT887354	hsa-miR-34a	CLIP-seq
MIRT887355	hsa-miR-34c-5p	CLIP-seq
MIRT887356	hsa-miR-3616-3p	CLIP-seq
MIRT887357	hsa-miR-3652	CLIP-seq
MIRT887358	hsa-miR-3680	CLIP-seq
MIRT1963204	hsa-miR-3907	CLIP-seq
MIRT887359	hsa-miR-4418	CLIP-seq
MIRT887360	hsa-miR-4423-5p	CLIP-seq
MIRT887361	hsa-miR-4430	CLIP-seq
MIRT887362	hsa-miR-4436b-3p	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT887363	hsa-miR-449a	CLIP-seq
MIRT887364	hsa-miR-449b	CLIP-seq
MIRT887365	hsa-miR-4705	CLIP-seq
MIRT887366	hsa-miR-509-3-5p	CLIP-seq
MIRT887367	hsa-miR-509-5p	CLIP-seq
MIRT1963205	hsa-miR-548u	CLIP-seq
MIRT887349	hsa-miR-1184	CLIP-seq
MIRT887352	hsa-miR-3135b	CLIP-seq
MIRT887354	hsa-miR-34a	CLIP-seq
MIRT887355	hsa-miR-34c-5p	CLIP-seq
MIRT887356	hsa-miR-3616-3p	CLIP-seq
MIRT887357	hsa-miR-3652	CLIP-seq
MIRT887358	hsa-miR-3680	CLIP-seq
MIRT1963204	hsa-miR-3907	CLIP-seq
MIRT887359	hsa-miR-4418	CLIP-seq
MIRT887360	hsa-miR-4423-5p	CLIP-seq
MIRT887361	hsa-miR-4430	CLIP-seq
MIRT887362	hsa-miR-4436b-3p	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT887363	hsa-miR-449a	CLIP-seq
MIRT887364	hsa-miR-449b	CLIP-seq
MIRT887365	hsa-miR-4705	CLIP-seq
MIRT887366	hsa-miR-509-3-5p	CLIP-seq
MIRT887367	hsa-miR-509-5p	CLIP-seq
MIRT1963204	hsa-miR-3907	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT1963205	hsa-miR-548u	CLIP-seq
MIRT1963204	hsa-miR-3907	CLIP-seq
MIRT1921564	hsa-miR-448	CLIP-seq
MIRT1963205	hsa-miR-548u	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002576	Process	Platelet degranulation	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006956	Process	Complement activation	TAS	1374388
GO:0006957	Process	Complement activation, alternative pathway	TAS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	1374388
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
134350	2771	ENSG00000197766

Protein

UniProt ID

P00746

Protein name

Complement factor D (EC 3.4.21.46) (Adipsin) (C3 convertase activator) (Properdin factor D)

Protein function

Serine protease that initiates the alternative pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed:21205667, PubMed:22362

PDB

1BIO , 1DFP , 1DIC , 1DST , 1DSU , 1FDP , 1HFD , 2XW9 , 2XWA , 2XWB , 4CBN , 4CBO , 4D9R , 5FBE , 5FBI , 5FCK , 5MT0 , 5MT4 , 5NAR , 5NAT , 5NAW , 5NB6 , 5NB7 , 5NBA , 5TCA , 5TCC , 6FTY , 6FTZ , 6FUG , 6FUH , 6FUI , 6FUJ , 6FUT , 6QMR , 6QMT , 6VMJ , 6VMK , 8D95 , 8DEA , 8DG6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	26 → 248	Trypsin	Domain

Sequence

MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA

Sequence length

253

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades Staphylococcus aureus infection Coronavirus disease - COVID-19		Platelet degranulation Alternative complement activation Neutrophil degranulation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Complement component deficiency	Complement Factor D Deficiency, Complement deficiency disease	rs387906509, rs1467298230, rs1022194067, rs774370086, rs121964922, rs372345940, rs121913052, rs121913053, rs460897, rs121913054, rs121913056, rs121913058, rs796052138, rs41286844, rs121909592 View all (29 more)	16527897, 29522842
Glomerulonephritis	Glomerulonephritis	rs778043831	14675043
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)	22832039

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Congestive heart failure	Congestive heart failure	26670611	ClinVar
Endometriosis	Endometriosis	21063030	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	26670611	ClinVar
Myocardial infarction	Myocardial Failure	26670611	ClinVar

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	31861421
Abortion Spontaneous	Associate	31861421
Adenocarcinoma of Lung	Associate	33870858
Asthma	Associate	29138487
Atrial Fibrillation	Associate	32389013, 36644582
Autoimmune Diseases of the Nervous System	Associate	30286468
Brain Neoplasms	Associate	26849056
Breast Neoplasms	Associate	34997107, 35037412
Carcinogenesis	Associate	28824723
Carcinoma Pancreatic Ductal	Associate	37533202
Cerebrovascular Disorders	Associate	37188751
Colorectal Neoplasms	Stimulate	34162701
Coronary Artery Disease	Associate	37188768
Cytokine Release Syndrome	Associate	29138487
Depressive Disorder	Associate	23064081
Diabetes Mellitus Type 2	Stimulate	35216336, 39209774
Embolic Stroke	Associate	36644582
Endometriosis	Associate	38456992
Geographic Atrophy	Associate	29801123
Graves Ophthalmopathy	Stimulate	37555734
Heart Diseases	Associate	28651038
Hypertension	Associate	39216506
Hypoxia	Associate	25889814
Immunologic Deficiency Syndromes	Associate	31440263
Inflammation	Stimulate	37006170
Inflammation	Associate	37173738
Leukemia Myeloid Acute	Associate	27473565, 37359050, 39506790, 39867885
Lipodystrophy Partial Acquired	Associate	34205507
Lupus Erythematosus Systemic	Associate	39290707
Macular Degeneration	Associate	31861421
Metabolic Syndrome	Associate	28075222, 35216336
Mood Disorders	Associate	23064081
Moyamoya Disease	Associate	39290707
Myocardial Infarction	Associate	32389013
Neoplasms	Associate	23038706, 28824723, 31740786, 34162701
Neoplasms Adipose Tissue	Associate	35216336
Nephrosclerosis	Associate	37188751
Obesity	Stimulate	31652917, 37006170
Obesity	Associate	35216336, 39209774
Osteoarthritis	Associate	32095874
Pain	Associate	27518164
Pneumonia Ventilator Associated	Associate	32031163
Polycystic Ovary Syndrome	Associate	35551681
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16029452
Prostatitis	Associate	23038706
Pulmonary Arterial Hypertension	Stimulate	28651038
Scleroderma Diffuse	Stimulate	28651038
Scleroderma Systemic	Associate	28651038
Squamous Cell Carcinoma of Head and Neck	Associate	18254958
Status Asthmaticus	Inhibit	29138487
Stomach Neoplasms	Associate	21931799, 39524442
Thyroid Neoplasms	Associate	30272326
Triple Negative Breast Neoplasms	Associate	34053447
Vascular Diseases	Associate	37188751

CFD (complement factor D)