ZNF366 (zinc finger protein 366)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
167465
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 366
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF366
Synonyms (NCBI Gene) Gene synonyms aliases
DC-SCRIPT, DCSCRIPT
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.2|5q13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(77)
miRTarBase ID miRNA Experiments Reference
MIRT517770 hsa-miR-3936 PAR-CLIP 22012620
MIRT517767 hsa-miR-3154 PAR-CLIP 22012620
MIRT517766 hsa-miR-3925-5p PAR-CLIP 22012620
MIRT517765 hsa-miR-3123 PAR-CLIP 22012620
MIRT517755 hsa-miR-411-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(19)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 17085477
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610159 18316 ENSG00000178175
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8N895
Protein name Zinc finger protein 366 (Dendritic cell-specific transcript protein) (DC-SCRIPT)
Protein function Has transcriptional repression activity. Acts as a corepressor of ESR1; the function seems to involve CTBP1 and histone deacetylases.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 253 → 275 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 309 → 331 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 337 → 359 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 → 387 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 393 → 415 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 421 → 443 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 449 → 471 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 477 → 499 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 505 → 530 Domain
PF00096 zf-C2H2 533 → 556 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in immature and mature dendritic cells (DCs). Not detected in other blood cell types. {ECO:0000269|PubMed:16393996}.
Sequence 
MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPP
PGDLDGFPGVFEGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPP
RPKYDSQMIDLCNVGFQFYRSLEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKV
HPGLMFPFFVPSSSPFPFSRHTFLPKQPPEPLLPRKAEPQESEETKQKVERVDVNVQIDD
SYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHM
LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHA
SGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP
YICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCH
LCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPS
KFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAK
VPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLE
EACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYF
KHRDESLKELLERKMEKQAVLLGI
Sequence length 744
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38015097
Breast Neoplasms Associate 21122099, 25663546, 25722978
Endometriosis Associate 25722978
Hypertension Associate 38103737
Neoplasms Associate 21122099, 25663546
Tertiary Lymphoid Structures Associate 21122099
Vascular Diseases Associate 19525478