Gene Gene information from NCBI Gene database.
Entrez ID 1672
Gene name Defensin beta 1
Gene symbol DEFB1
Synonyms (NCBI Gene)
BD1DEFB-1DEFB101HBD1
Chromosome 8
Chromosome location 8p23.1
Summary Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithel
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT755820 hsa-miR-186-5p Western blottingqRT-PCR 36678471
MIRT755821 hsa-miR-340-5p Western blottingqRT-PCR 36678471
MIRT931952 hsa-miR-3163 CLIP-seq
MIRT931953 hsa-miR-340 CLIP-seq
MIRT931954 hsa-miR-579 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
HDAC1 Unknown 23185513
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0002227 Process Innate immune response in mucosa IBA
GO:0002227 Process Innate immune response in mucosa IDA 12860195
GO:0005515 Function Protein binding IPI 25122636, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602056 2766 ENSG00000164825
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P60022
Protein name Beta-defensin 1 (BD-1) (hBD-1) (Defensin, beta 1)
Protein function Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is impo
PDB 1E4S , 1IJU , 1IJV , 1KJ5 , 2NLB , 2NLC , 2NLD , 2NLE , 2NLF , 2NLG , 2NLH , 2NLP , 2NLQ , 2NLS , 2PLZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00711 Defensin_beta 33 68 Beta defensin Domain
Tissue specificity TISSUE SPECIFICITY: Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level). {ECO:0000269|PubMed:25122636, ECO:00
Sequence
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
RGKAKCCK
Sequence length 68
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ABC transporters
Staphylococcus aureus infection
  Beta defensins
Defensins