DEFA5 (defensin alpha 5)

Gene

• Entrez ID: 1670
• Gene name: Defensin alpha 5
• Gene symbol: DEFA5
• Synonyms (NCBI Gene): DEF5, HD-5
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025903	hsa-miR-7-5p	Microarray	17612493
MIRT931911	hsa-miR-4307	CLIP-seq
MIRT931912	hsa-miR-4436a	CLIP-seq
MIRT2211297	hsa-miR-4457	CLIP-seq
MIRT2211298	hsa-miR-4672	CLIP-seq
MIRT2211299	hsa-miR-4731-3p	CLIP-seq
MIRT2211300	hsa-miR-4797-5p	CLIP-seq
MIRT2211301	hsa-miR-4801	CLIP-seq
MIRT2211302	hsa-miR-624	CLIP-seq
MIRT931912	hsa-miR-4436a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TCF4	Unknown	19221600

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32437749
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9588893
GO:0005615	Component	Extracellular space	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006952	Process	Defense response	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0030133	Component	Transport vesicle	IEA
GO:0030141	Component	Secretory granule	IDA	9588893
GO:0030496	Component	Midbody	IDA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	15616305, 17088326
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19589339
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	17088326, 22573326, 25782105
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	21861459
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	12660734, 19589339, 22573326, 25354318, 30808760
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	21861459
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	19589339, 22573326, 25354318, 30808760
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	21861459
GO:0050832	Process	Defense response to fungus	IEA
GO:0051289	Process	Protein homotetramerization	IDA	23163963
GO:0051673	Process	Disruption of plasma membrane integrity in another organism	IBA
GO:0051873	Process	Killing by host of symbiont cells	IDA	9169780
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IC	15616305
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12660734, 25782105
GO:0140911	Function	Pore-forming activity	IBA
GO:1905710	Process	Positive regulation of membrane permeability	IMP	21861459

Other IDs

• MIM: 600472
• HGNC: 2764
• e!Ensembl: ENSG00000164816

Protein

• UniProt ID: Q01523
• Protein name: Defensin alpha 5 (Defensin-5) (HD5(20-94)) [Cleaved into: HD5(23-94); HD5(29-94); HD5(56-94); HD5(63-94)]
• Protein function: Host-defense peptide that maintains sterility in the urogenital system (PubMed:12021776, PubMed:12660734, PubMed:15616305, PubMed:19589339, PubMed:22359618, PubMed:22573326, PubMed:25354318, PubMed:25782105, PubMed:30808760). Has antimicrobial a
• PDB: 1ZMP, 2LXZ, 2MIT, 3I5W, 4E82, 4E83, 4E86, 4RBW, 4RBX, 5CUI, 5CUJ, 5CUM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00879	Defensin_propep	1 → 50	Defensin propeptide	Family
  PF00323	Defensin_1	65 → 93	Mammalian defensin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the gastrointestinal, reproductive, and urinary tracts (at protein level) (PubMed:12021776, PubMed:1429669, PubMed:22359618, PubMed:9588893). Expressed in Paneth cells of the small intestine (at protein level) (PubMed:1202
• Sequence:

  MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQ
  ARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

• Sequence length: 94

Pathways

KEGG:

NOD-like receptor signaling pathway
Staphylococcus aureus infection
Transcriptional misregulation in cancer

Reactome:

Defensins
Alpha-defensins

<