DEFA3 (defensin alpha 3)

Gene

• Entrez ID: 1668
• Gene name: Defensin alpha 3
• Gene symbol: DEFA3
• Synonyms (NCBI Gene): DEF3, HNP-3, HNP3, HP-3, HP3
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028746	hsa-miR-26b-5p	Microarray	19088304

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	10706719

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12860195, 21861873
GO:0005615	Component	Extracellular space	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006952	Process	Defense response	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	21861873
GO:0031640	Process	Killing of cells of another organism	IDA	15616305
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	2006422
GO:0045087	Process	Innate immune response	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0050832	Process	Defense response to fungus	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051673	Process	Disruption of plasma membrane integrity in another organism	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IC	15616305
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0140911	Function	Pore-forming activity	IBA

Other IDs

• MIM: 604522
• HGNC: 2762
• e!Ensembl: ENSG00000239839

Protein

• UniProt ID: P59666
• Protein name: Neutrophil defensin 3 (Defensin, alpha 3) (HNP-3) (HP-3) (HP3) [Cleaved into: HP 3-56; Neutrophil defensin 2 (HNP-2) (HP-2) (HP2)]
• Protein function: Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses (PubMed:15616305, PubMed:15772169, PubMed:17142766). Possesses the ability t
• PDB: 1DFN, 1ZMH, 1ZMI, 1ZMK, 2PM4, 2PM5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00879	Defensin_propep	1 → 52	Defensin propeptide	Family
  PF00323	Defensin_1	66 → 94	Mammalian defensin	Domain

• Sequence:

  MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
  RKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

• Sequence length: 94

Pathways

KEGG:

NOD-like receptor signaling pathway
Staphylococcus aureus infection
Transcriptional misregulation in cancer

Reactome:

Defensins
Alpha-defensins