TRIM60 (tripartite motif containing 60)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
166655
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 60
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM60
Synonyms (NCBI Gene) Gene synonyms aliases
RNF129, RNF33
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Pseudogenes of this gene are located on more than six
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT1455487 hsa-miR-1276 CLIP-seq
MIRT1455488 hsa-miR-198 CLIP-seq
MIRT1455489 hsa-miR-4311 CLIP-seq
MIRT1455490 hsa-miR-583 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA 21873635
GO:0008270 Function Zinc ion binding IEA
GO:0010468 Process Regulation of gene expression IBA 21873635
GO:0016567 Process Protein ubiquitination IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
619416 21162 ENSG00000176979
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q495X7
Protein name Tripartite motif-containing protein 60 (RING finger protein 129) (RING finger protein 33)
Protein function E3 SUMO-protein ligase that mediates SUMOylation of TAB2 leading to inhibition of NF-kappa-B and MAPK pathways by suppressing the TRAF6/TAB2/TAK1 complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 → 56 Domain
PF00643 zf-B_box 92 → 133 B-box zinc finger Domain
PF13765 PRY 297 → 345 SPRY-associated domain Family
PF00622 SPRY 349 → 465 SPRY domain Family
Sequence 
MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLSVSWKDLDDTFPCPVCRFCF
PYKSFRRNPQLRNLTEIAKQLQIRRSKRKRQKENAMCEKHNQFLTLFCVKDLEILCTQCS
FSTKHQKHYICPIKKAASYHREILEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKR
EEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGK
SVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILD
LNTAHPQLLVSEDRKAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKP
KWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER
Sequence length 471
Interactions View interactions