Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	166614
Gene name Gene Name - the full gene name approved by the HGNC.	Doublecortin like kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DCLK2
Synonyms (NCBI Gene) Gene synonyms aliases	CL2, CLICK-II, CLICK2, CLIK2, DCAMKL2, DCDC3, DCDC3B, DCK2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q31.23-q31.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/t

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT518271	hsa-miR-4644	PAR-CLIP	23446348
MIRT518271	hsa-miR-4644	PAR-CLIP	27292025
MIRT518271	hsa-miR-4644	PAR-CLIP	23446348
MIRT926179	hsa-miR-137	CLIP-seq
MIRT926180	hsa-miR-25	CLIP-seq
MIRT926181	hsa-miR-32	CLIP-seq
MIRT926182	hsa-miR-363	CLIP-seq
MIRT926183	hsa-miR-3665	CLIP-seq
MIRT926184	hsa-miR-367	CLIP-seq
MIRT926185	hsa-miR-561	CLIP-seq
MIRT926186	hsa-miR-657	CLIP-seq
MIRT926187	hsa-miR-92a	CLIP-seq
MIRT926188	hsa-miR-92b	CLIP-seq
MIRT1974380	hsa-miR-127-5p	CLIP-seq
MIRT1974381	hsa-miR-3065-5p	CLIP-seq
MIRT1974382	hsa-miR-3607-3p	CLIP-seq
MIRT1974383	hsa-miR-3662	CLIP-seq
MIRT1974384	hsa-miR-495	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32707033, 33199366, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021860	Process	Pyramidal neuron development	IEA
GO:0034504	Process	Protein localization to nucleus	IBA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA

MIM	HGNC	e!Ensembl
613166	19002	ENSG00000170390

Protein

UniProt ID

Q8N568

Protein name

Serine/threonine-protein kinase DCLK2 (EC 2.7.11.1) (CaMK-like CREB regulatory kinase 2) (CL2) (CLICK-II) (CLICK2) (Doublecortin domain-containing protein 3B) (Doublecortin-like and CAM kinase-like 2) (Doublecortin-like kinase 2)

Protein function

Protein kinase with a significantly reduced C(a2+)/CAM affinity and dependence compared to other members of the CaMK family. May play a role in the down-regulation of CRE-dependent gene activation probably by phosphorylation of the CREB coactiva

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03607	DCX	90 → 152	Doublecortin	Family
PF03607	DCX	215 → 274	Doublecortin	Family
PF00069	Pkinase	394 → 651	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, heart and eyes. {ECO:0000269|PubMed:18075264}.

Sequence

MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSSSGPKGNGLIPSPAHSAHCSFYRTR
TLQALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV
RTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRALAAA
SSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSG
VVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSA
VKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISAHGRS
SSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEF
ALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDA
ITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGL
ATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQED
LFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQENN
MQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEPISP
VPPSVEEIPVPGEAVPAPTPPESPTPHPPPAAPGGERAGTWRRHRD

Sequence length

766

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Renal Cell	Associate	38211588
Ectodermal Dysplasia	Associate	31578829
Kidney Diseases	Associate	38211588
Leukemia Prolymphocytic T Cell	Associate	31919093
Microcephaly	Associate	31578829

DCLK2 (doublecortin like kinase 2)