Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1666
Gene name Gene Name - the full gene name approved by the HGNC.	2,4-dienoyl-CoA reductase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DECR1
Synonyms (NCBI Gene) Gene synonyms aliases	DECR, NADPH, SDR18C1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT545687	hsa-miR-4773	PAR-CLIP	21572407
MIRT545686	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT545685	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT545684	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT545683	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT545682	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT545681	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT545680	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT545679	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT545678	hsa-miR-646	PAR-CLIP	21572407
MIRT545677	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT545676	hsa-miR-589-5p	PAR-CLIP	21572407
MIRT545675	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT545674	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT545673	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT545672	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT545671	hsa-miR-107	PAR-CLIP	21572407
MIRT545669	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT545670	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT545668	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT545667	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT545666	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT545687	hsa-miR-4773	PAR-CLIP	21572407
MIRT545686	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT545685	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT545684	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT545683	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT545682	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT545681	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT545680	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT545679	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT545678	hsa-miR-646	PAR-CLIP	21572407
MIRT545677	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT545676	hsa-miR-589-5p	PAR-CLIP	21572407
MIRT545675	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT545674	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT545673	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT545672	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT545671	hsa-miR-107	PAR-CLIP	21572407
MIRT545669	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT545670	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT545668	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT545667	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT545666	hsa-miR-374b-3p	PAR-CLIP	21572407

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	NAS	7818482
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006635	Process	Fatty acid beta-oxidation	IDA	15531764
GO:0006635	Process	Fatty acid beta-oxidation	TAS
GO:0008670	Function	2,4-dienoyl-CoA reductase (NADPH) activity	IDA	15531764
GO:0042802	Function	Identical protein binding	IPI	15531764
GO:0070402	Function	NADPH binding	IDA	15531764
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	19578400
GO:1902494	Component	Catalytic complex	IDA	15531764

MIM	HGNC	e!Ensembl
222745	2753	ENSG00000104325

Protein

UniProt ID

Q16698

Protein name

2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial (EC 1.3.1.124) (2,4-dienoyl-CoA reductase [NADPH]) (4-enoyl-CoA reductase [NADPH]) (Short chain dehydrogenase/reductase family 18C member 1)

Protein function

Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in mitochondria. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA t

PDB

1W6U , 1W73 , 1W8D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	65 → 304		Domain

Tissue specificity

TISSUE SPECIFICITY: Heart = liver = pancreas > kidney >> skeletal muscle = lung. {ECO:0000269|PubMed:7818482}.

Sequence

MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGK
VAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRD
PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIG
KQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQP
GPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFD
GGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS

Sequence length

335

Interactions

View interactions

	Reactome
			mitochondrial fatty acid beta-oxidation of unsaturated fatty acids

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21926974

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Progressive Encephalopathy With Leukodystrophy	progressive encephalopathy with leukodystrophy due to DECR deficiency	GenCC
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	7669561
Anemia Sickle Cell	Associate	21114906
Aortic Aneurysm Abdominal	Associate	28735510
Cardiomyopathies	Associate	35971449
Diabetes Mellitus Type 2	Associate	32802835, 32991460
Down Syndrome	Associate	19026285, 22377700
Fetal Growth Retardation	Associate	27330572
Folate Malabsorption Hereditary	Associate	19026285
Granulomatous Disease Chronic	Associate	10498624, 20724480, 30924925, 31681257
Heart Failure	Associate	32802835
Hypoxia Brain	Stimulate	8065332
Inflammation	Associate	26410779
Mycoses	Associate	31681257
Neoplasm Metastasis	Associate	32686647
Neoplasms	Associate	17574288
Prostatic Neoplasms	Stimulate	32686647
Prostatitis	Associate	32686647

DECR1 (2,4-dienoyl-CoA reductase 1)