Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	166
Gene name Gene Name - the full gene name approved by the HGNC.	TLE family member 5, transcriptional modulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TLE5
Synonyms (NCBI Gene) Gene synonyms aliases	AES, AES-1, AES-2, ESP1, GRG, GRG5, Grg-5
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of protein

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	10660609
GO:0001501	Process	Skeletal system development	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	19460168
GO:0003714	Function	Transcription corepressor activity	IPI	10660609
GO:0005515	Function	Protein binding	IPI	10660609, 11390640, 12441302, 15006356, 22952044, 23732115, 25416956, 29892012, 31515488, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	22952044
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0007275	Process	Multicellular organism development	TAS	8365415
GO:0009887	Process	Animal organ morphogenesis	TAS	9809752
GO:0010629	Process	Negative regulation of gene expression	IMP	15006356
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0031668	Process	Cellular response to extracellular stimulus	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	15489227
GO:0040008	Process	Regulation of growth	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	19460168
GO:0060761	Process	Negative regulation of response to cytokine stimulus	IMP	15489227
GO:0070491	Function	Repressing transcription factor binding	IBA	21873635
GO:0070555	Process	Response to interleukin-1	IDA	15489227
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	19460168
GO:2000210	Process	Positive regulation of anoikis	IMP	15006356

MIM	HGNC	e!Ensembl
600188	307	ENSG00000104964

Protein

UniProt ID

Q08117

Protein name

TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator)

Protein function

Transcriptional corepressor. Acts as a dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03920	TLE_N	2 → 132	Groucho/TLE N-terminal Q-rich domain	Family

Tissue specificity

TISSUE SPECIFICITY: Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.

Sequence

MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRH
YVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELN
SIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDK
NGHDGDTHQEDDGEKSD

Sequence length

197

Interactions

View interactions

TLE5 (TLE family member 5, transcriptional modulator)