Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1649
Gene name	DNA damage inducible transcript 3
Gene symbol	DDIT3
Synonyms (NCBI Gene)	AltDDIT3C/EBPzetaCEBPZCHOPCHOP-10CHOP10GADD153
Chromosome	12
Chromosome location	12q13.3
Summary	This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator prote

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016927	hsa-miR-335-5p	Microarray	18185580
MIRT023280	hsa-miR-122-5p	Other	21750653
MIRT027903	hsa-miR-96-5p	Sequencing	20371350
MIRT054455	hsa-miR-211-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24039954
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT512375	hsa-miR-633	PAR-CLIP	20371350
MIRT525507	hsa-miR-5692a	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	22012620
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	22012620
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT512375	hsa-miR-633	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT512375	hsa-miR-633	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	26701625
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	26701625
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	26701625
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	26701625
MIRT512375	hsa-miR-633	PAR-CLIP	26701625
MIRT512375	hsa-miR-633	PAR-CLIP	26701625
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT512375	hsa-miR-633	PAR-CLIP	20371350
MIRT525507	hsa-miR-5692a	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	22012620
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	22012620
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT512375	hsa-miR-633	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT512375	hsa-miR-633	PAR-CLIP	23446348
MIRT929252	hsa-miR-216b	CLIP-seq
MIRT929253	hsa-miR-224	CLIP-seq
MIRT929254	hsa-miR-3675-3p	CLIP-seq
MIRT929255	hsa-miR-376a	CLIP-seq
MIRT929256	hsa-miR-376b	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq
MIRT2210530	hsa-miR-1271	CLIP-seq
MIRT2210531	hsa-miR-1275	CLIP-seq
MIRT2210532	hsa-miR-142-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2210535	hsa-miR-3136-3p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2210539	hsa-miR-3199	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210541	hsa-miR-4447	CLIP-seq
MIRT2210542	hsa-miR-4472	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210544	hsa-miR-4525	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210547	hsa-miR-4652-5p	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210550	hsa-miR-4665-5p	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210552	hsa-miR-4723-5p	CLIP-seq
MIRT2210553	hsa-miR-4740-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2210555	hsa-miR-625	CLIP-seq
MIRT2210556	hsa-miR-644	CLIP-seq
MIRT2210557	hsa-miR-648	CLIP-seq
MIRT2210558	hsa-miR-663b	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2210560	hsa-miR-96	CLIP-seq
MIRT2210530	hsa-miR-1271	CLIP-seq
MIRT2210532	hsa-miR-142-3p	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2514511	hsa-miR-3124-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2210535	hsa-miR-3136-3p	CLIP-seq
MIRT2514512	hsa-miR-3145-5p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2514513	hsa-miR-3193	CLIP-seq
MIRT2514514	hsa-miR-3614-3p	CLIP-seq
MIRT2514515	hsa-miR-3618	CLIP-seq
MIRT2514516	hsa-miR-3679-3p	CLIP-seq
MIRT2514517	hsa-miR-4297	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2514518	hsa-miR-4786-5p	CLIP-seq
MIRT2514519	hsa-miR-508-5p	CLIP-seq
MIRT2210556	hsa-miR-644	CLIP-seq
MIRT2210557	hsa-miR-648	CLIP-seq
MIRT2210558	hsa-miR-663b	CLIP-seq
MIRT2514520	hsa-miR-769-5p	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2514521	hsa-miR-934	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq
MIRT2210560	hsa-miR-96	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2514511	hsa-miR-3124-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2514512	hsa-miR-3145-5p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2514513	hsa-miR-3193	CLIP-seq
MIRT2514514	hsa-miR-3614-3p	CLIP-seq
MIRT2514515	hsa-miR-3618	CLIP-seq
MIRT2514516	hsa-miR-3679-3p	CLIP-seq
MIRT2514517	hsa-miR-4297	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2514518	hsa-miR-4786-5p	CLIP-seq
MIRT2514519	hsa-miR-508-5p	CLIP-seq
MIRT2514520	hsa-miR-769-5p	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2514521	hsa-miR-934	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq

Show/Hide all (17)

Transcription factor	Regulation	Reference
ATF3	Activation	22753726
ATF4	Activation	16246168;17276738;20020050;21044953;21966512
ATF4	Unknown	17455323;22691366
ATF6	Unknown	17455323
BRCA1	Activation	21700680
CEBPB	Unknown	16757577
CEBPD	Activation	20971808
CEBPD	Repression	22347430
E2F1	Unknown	20971808
FOS	Activation	20188076
FUS	Activation	11162437
JDP2	Repression	18396163
JUN	Activation	22622069
NFYA	Unknown	20023394
RB1	Unknown	20971808
STAT3	Repression	23288901
XBP1	Unknown	17455323

144

Show/Hide all (144)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24038088
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16434966, 18940792
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	11478948
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISO
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IC	15322075
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	24939851
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	22065586
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	22065586
GO:0001955	Process	Blood vessel maturation	IEA
GO:0002086	Process	Diaphragm contraction	IEA
GO:0003677	Function	DNA binding	IDA	14667815, 18940792
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15322075, 30639358
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IGI	24939851
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	NAS	8510758
GO:0003714	Function	Transcription corepressor activity	IDA	24038088
GO:0003714	Function	Transcription corepressor activity	IGI	11478948
GO:0005515	Function	Protein binding	IPI	15775988, 16189514, 17872950, 18330356, 18940792, 20102225, 20211142, 20562859, 20829347, 21988832, 22761832, 23661758, 25416956, 27107012, 29083303, 29997244, 31467278, 32296183, 32814053, 32911434, 33961781, 34799561, 37398436
GO:0005634	Component	Nucleus	IDA	11478948, 15322075, 20829347, 22761832, 29083303, 33384352
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8622660, 8657121, 20102225, 23661758
GO:0005667	Component	Transcription regulator complex	NAS	15775988
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29083303
GO:0005737	Component	Cytoplasm	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005829	Component	Cytosol	TAS	14685163
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	17872950, 22761832
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	14667815
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8622660
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	TAS	1339368
GO:0006983	Process	ER overload response	IBA
GO:0006983	Process	ER overload response	IEA
GO:0006986	Process	Response to unfolded protein	IDA	18940792
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008140	Function	CAMP response element binding protein binding	IEA
GO:0008140	Function	CAMP response element binding protein binding	IPI	11478948
GO:0008140	Function	CAMP response element binding protein binding	ISS
GO:0009611	Process	Response to wounding	IEA
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0009948	Process	Anterior/posterior axis specification	ISS	16434966
GO:0010467	Process	Gene expression	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IMP	24038088
GO:0032700	Process	Negative regulation of interleukin-17 production	IMP	24038088
GO:0032713	Process	Negative regulation of interleukin-4 production	IMP	24038088
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	20829347
GO:0032993	Component	Protein-DNA complex	IDA	15322075
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	18940792, 19061639, 20829347, 24939851, 33384352
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IGI	15775988
GO:0036119	Process	Response to platelet-derived growth factor	IEA
GO:0036488	Component	CHOP-C/EBP complex	IBA
GO:0036488	Component	CHOP-C/EBP complex	IEA
GO:0036488	Component	CHOP-C/EBP complex	IPI	20102225
GO:0036488	Component	CHOP-C/EBP complex	ISS
GO:0036488	Component	CHOP-C/EBP complex	TAS	14685163
GO:0036499	Process	PERK-mediated unfolded protein response	TAS	14685163, 22934019
GO:0036500	Process	ATF6-mediated unfolded protein response	TAS	22934019
GO:0042594	Process	Response to starvation	IEA
GO:0042802	Function	Identical protein binding	IPI	20562859, 23661758
GO:0042803	Function	Protein homodimerization activity	IDA	18534616
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	17872950
GO:0043522	Function	Leucine zipper domain binding	IDA	8622660, 11478948
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IMP	22761832
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045454	Process	Cell redox homeostasis	IDA	14667815
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18940792
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15322075, 15775988
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15322075, 22065586, 24939851
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	15775988
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22065586, 22761832
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046982	Function	Protein heterodimerization activity	IBA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	8622660
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	18534616
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	22761832
GO:0060840	Process	Artery development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16434966
GO:0061771	Process	Response to caloric restriction	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	18940792, 20829347
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	15322075
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163, 22934019
GO:0070509	Process	Calcium ion import	IEA
GO:0072655	Process	Establishment of protein localization to mitochondrion	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS	16434966
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26370079
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:0140467	Process	Integrated stress response signaling	IDA	30639358
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:0140468	Process	HRI-mediated signaling	IDA	32132706, 32132707
GO:0140537	Function	Transcription regulator activator activity	IEA
GO:0140537	Function	Transcription regulator activator activity	ISS
GO:0160144	Process	GDF15-GFRAL signaling pathway	IDA	31535977
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	22761832
GO:1904738	Process	Vascular associated smooth muscle cell migration	IEA
GO:1990442	Process	Intrinsic apoptotic signaling pathway in response to nitrosative stress	IEA
GO:1990617	Component	CHOP-ATF4 complex	IBA
GO:1990617	Component	CHOP-ATF4 complex	IDA	11478948
GO:1990617	Component	CHOP-ATF4 complex	IPI	18940792
GO:1990622	Component	CHOP-ATF3 complex	IBA
GO:1990622	Component	CHOP-ATF3 complex	IDA	8622660
GO:1990874	Process	Vascular associated smooth muscle cell proliferation	IEA
GO:2000016	Process	Negative regulation of determination of dorsal identity	IDA	16434966
GO:2000016	Process	Negative regulation of determination of dorsal identity	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958

MIM	HGNC	e!Ensembl
126337	2726	ENSG00000175197

P0DPQ6

Protein name

DDIT3 upstream open reading frame protein (Alternative DDIT3 protein) (AltDDIT3)

Protein function

[Isoform AltDDIT3]: Product of the upstream open reading frame (uORF) of DDIT3/CHOP that is specifically produced in absence of stress, thereby preventing translation of downstream stress effector DDIT3/CHOP.

Family and domains

Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Sequence length

P35638

Protein name

DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)

Protein function

Multifunctional transcription factor in endoplasmic reticulum (ER) stress response (PubMed:15322075, PubMed:15775988, PubMed:19672300). Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and

Family and domains

Sequence

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Sequence length

169

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Protein processing in endoplasmic reticulum Apoptosis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Transcriptional misregulation in cancer Lipid and atherosclerosis		FOXO-mediated transcription of cell death genes

DDIT3 (DNA damage inducible transcript 3)