Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1649
Gene name Gene Name - the full gene name approved by the HGNC.
DNA damage inducible transcript 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DDIT3
Synonyms (NCBI Gene) Gene synonyms aliases
AltDDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator prote
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016927 hsa-miR-335-5p Microarray 18185580
MIRT023280 hsa-miR-122-5p Other 21750653
MIRT027903 hsa-miR-96-5p Sequencing 20371350
MIRT054455 hsa-miR-211-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24039954
MIRT512378 hsa-miR-7845-5p PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
ATF3 Activation 22753726
ATF4 Activation 16246168;17276738;20020050;21044953;21966512
ATF4 Unknown 17455323;22691366
ATF6 Unknown 17455323
BRCA1 Activation 21700680
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 24038088
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16434966, 18940792
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IGI 11478948
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
126337 2726 ENSG00000175197
Protein
UniProt ID P0DPQ6
Protein name DDIT3 upstream open reading frame protein (Alternative DDIT3 protein) (AltDDIT3)
Protein function [Isoform AltDDIT3]: Product of the upstream open reading frame (uORF) of DDIT3/CHOP that is specifically produced in absence of stress, thereby preventing translation of downstream stress effector DDIT3/CHOP.
Family and domains
Sequence
MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT
Sequence length 34
UniProt ID P35638
Protein name DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)
Protein function Multifunctional transcription factor in endoplasmic reticulum (ER) stress response (PubMed:15322075, PubMed:15775988, PubMed:19672300). Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and
Family and domains
Sequence
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Sequence length 169
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Transcriptional misregulation in cancer
Lipid and atherosclerosis
  FOXO-mediated transcription of cell death genes
<