Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	164781
Gene name Gene Name - the full gene name approved by the HGNC.	Dynein assembly factor with WD repeats 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DAW1
Synonyms (NCBI Gene) Gene synonyms aliases	CILD52, DNAAF18, ODA16, WDR69
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q36.3

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	IEA
GO:0005515	Function	Protein binding	IPI	18852297
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	ISS
GO:0036158	Process	Outer dynein arm assembly	IEA
GO:0036158	Process	Outer dynein arm assembly	ISS
GO:0042073	Process	Intraciliary transport	ISS
GO:0042995	Component	Cell projection	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0070286	Process	Axonemal dynein complex assembly	IEA
GO:0090660	Process	Cerebrospinal fluid circulation	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA

MIM	HGNC	e!Ensembl
620279	26383	ENSG00000123977

Protein

UniProt ID

Q8N136

Protein name

Dynein assembly factor with WD repeat domains 1 (Outer row dynein assembly protein 16 homolog) (WD repeat-containing protein 69)

Protein function

Required for axonemal dynein assembly and ciliary motility in ciliated organs, including Kupffer's vesicle, during embryogenesis (PubMed:36074124). Facilitates the onset of robust cilia motility during development (PubMed:36074124). {ECO:0000269

PDB

5NNZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	82 → 120	WD domain, G-beta repeat	Repeat
PF00400	WD40	124 → 163	WD domain, G-beta repeat	Repeat
PF00400	WD40	167 → 205	WD domain, G-beta repeat	Repeat
PF00400	WD40	209 → 247	WD domain, G-beta repeat	Repeat
PF00400	WD40	251 → 289	WD domain, G-beta repeat	Repeat
PF00400	WD40	293 → 331	WD domain, G-beta repeat	Repeat
PF00400	WD40	335 → 373	WD domain, G-beta repeat	Repeat
PF00400	WD40	377 → 415	WD domain, G-beta repeat	Repeat

Sequence

MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRT
EQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWD
TASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEI
VCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFD
HTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLT
GHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHL
LTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR

Sequence length

415

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Ciliary dyskinesia	ciliary dyskinesia, primary, 52	N/A	N/A	GenCC
Dementia	Dementia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	33634306

DAW1 (dynein assembly factor with WD repeats 1)